KEGG   Bordetella parapertussis Bpp5: BN117_2395Help
Entry
BN117_2395        CDS       T02297                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00010  Glycolysis / Gluconeogenesis
bpar00020  Citrate cycle (TCA cycle)
bpar00620  Pyruvate metabolism
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01200  Carbon metabolism
Module
bpar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN117_2395 (aceF)
   00020 Citrate cycle (TCA cycle)
    BN117_2395 (aceF)
   00620 Pyruvate metabolism
    BN117_2395 (aceF)
Enzymes [BR:bpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN117_2395 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 PYNP_C RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-GeneID: 13890432
NCBI-ProteinID: YP_006896300
UniProt: K0MIQ7
Position
2591424..2593085
Genome map
AA seq 553 aa AA seqDB search
MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKASMEIPASAAGVVKSV
KVKVGDKIAEGTVILEVEAAGEAAAAPKAEQAPEAAEAPKADAAKAEAPQAEAPAPAGPI
EVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASMEIPASAGGVVQSLKVKVG
DKVAMGTVIAVVQGQGAAAPAAKAEAQAAAEPAASVPAPAPAPAPAPAPAPAQRPAPAAA
LQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITADDVRAYVKQALSAGAPA
GASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTNNDEAD
ITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQYYHIG
FAADTPNGLVVPVVRDADKKGILELARETSELARKAREGKVSPAEMQGGCFSISSLGGIG
GTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLPLSLSYDHRVIDGASAARFNAY
LGQLLADFRRIAL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgtggaaatcaaggtaccggacatcggtgacttcaaggaggtggaagtc
atcgaggtgctggtatcggcgggcgacacgatcaaggccgagcaaagcctgatcacggtg
gagtccgacaaggcatcgatggagattccggcctcggccgcgggcgtggtgaagtcggtc
aaggtcaaggtgggcgacaagatcgccgagggcacggtcatcctggaagtggaggcggcc
ggcgaggccgccgccgcgcccaaggccgagcaggcccccgaggccgccgaggcgcccaag
gccgacgccgcgaaggccgaggcgccccaggccgaggcgccggcccccgccggcccgatc
gaagtcaaggtgcccgatatcggcgacttcaaggaagtcgaggtcatcgaggtgctggtc
gccgagggcgacaccatcaaggccgagcaaagcctgatcacggtggagtccgacaaggcc
tcgatggaaatcccggcctcggcgggcggcgtggtgcagtcgctcaaggtcaaggtaggc
gacaaggtcgcgatgggcacggtcatcgccgtggtgcagggccagggcgcagccgccccg
gccgccaaggccgaggcgcaggcggcagccgagcctgccgcgtcggtcccggctccggcc
ccggccccggcgccggcgccggctccggctccggcgcagcggcccgccccggccgccgcg
ctgcaggacgaagacctcaagcccggccaattgccgcatgcctcgccgtcggtgcgcaag
ttcgcgcgcgagctgggcgtgaacctgagccgggtcaccggctcggccgccaagggccgc
atcacggccgatgacgtgcgcgcctacgtgaagcaggcgctgtcggccggcgcgccggct
ggcgcctcgggcggcggcgatggcgccgcgctggggctgctgccgtggcccaagatcgat
ttcaccaagttcggccccatcgaagccaagccgctgtcgcgcatcaagaagatctcgggc
gccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaacaacgacgaagcggac
atcaccgacctggaggcgctgcgcgtggcgctgaacaaggaaaacgagaaatcgggcgtc
aaggtcaccatgctggccttcctgatcaaggcggtggtcgcggcgctgaagaaattcccc
gagttcaacgcctcgctggatggcgacaacctggtgctcaagcagtactaccacatcggc
ttcgccgccgacacgcccaacgggctggtggtgccggtggtgcgcgacgccgacaagaag
ggcatcctggagctggcccgcgaaacctccgagctggccaggaaggctcgcgaaggcaag
gtctcgcccgccgagatgcagggcggctgcttctcgatctcgtcgctgggcggcatcggc
ggcacgcatttcacgcccatcatcaacgcgcccgaagtggccatcctgggcgtgtcgcgc
tcggcccacaagccggtctgggacggcaagcagttcgtgccgcgcctgaccctgccgctg
tcgctgtcctatgaccaccgcgtcatcgacggcgcctcggcggcgcgcttcaacgcctat
ctcggccagctgctggccgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system