KEGG   Bordetella parapertussis Bpp5: BN117_2510Help
Entry
BN117_2510        CDS       T02297                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN117_2510
Enzymes [BR:bpar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BN117_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2701326..2702309)
Genome map
AA seq 327 aa AA seqDB search
MPSPSALHDLCDTPPTFMGVPHRHAIDGARAAILGIPFDCGTHAFRIGARQGPQSIREQS
RLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQAVGAIVDGGAVPVTMGG
DGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGTQFTHAALEGRVDTSLAF
HIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDLRARLGERPVYLCLDMDVL
DPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTVSPPHDVNGTTASLAAALMV
EGLVLLCKRLGLDHPDPAPDFAAMYAR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccccagcgcgctgcatgacctgtgcgacacgccacctaccttcatgggcgtg
ccccatcgccatgccatcgacggcgccagggcagccatcctcggcatccccttcgattgc
ggcacgcacgcgtttcgcatcggcgcgcgccagggtccgcagtcgatccgcgaacagtcg
cgcctgatgcgcaccttcaaccccgaactggccgactacaacccgctgcagcggctcggg
gtgatcgactgcggcaacgtgcgcgtggtgcccagcgacattctcgatgccttcgagcgc
attgagcaggcggtcggcgccatcgtcgatggcggcgcggtgccggtcaccatgggcggc
gacggcagcgtgtcgctgccgcaactgcgcgcggtcggcaaacgccatccgggcctggcc
gtcatccacctcgactcgcacaccgacaccaacaccttcgtcaagggcaaggaatacaac
gccggcacgcagttcacgcacgccgccctggaaggccgcgtggacacctcgctggcgttt
catatcggcacgcgcggcaccaccttcacccagcatgtgttccgccatgcgcgccacttc
ggctaccagatcatcccgctcaacgagctgctggcgcgcggcatggccgaagtgctgcag
gacctgcgcgcgcgcctgggcgaacggccggtctacctgtgcctggacatggacgtgctg
gatccgtcctgcgcgcccggggtatgcgcgcccagctggggcggcctgagcgcgcgcgag
gcgatcgcgttcctgcgcgggctggccggcctgaacatcgtcgccatcgacgtcaatacg
gtcagcccgccgcacgacgtcaatgggaccacggcatcgctggcggccgcgctgatggtc
gaaggcctggtgctgctgtgcaagcgcctggggctggaccatcccgacccggcgcccgac
ttcgccgccatgtacgcgcgctga

DBGET integrated database retrieval system