KEGG   Bordetella parapertussis Bpp5: BN117_2539Help
Entry
BN117_2539        CDS       T02297                                 

Gene name
gst
Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2730307..2730930)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGADFDRVKLDFGATQQQSPDYLRVNPKGRVPALATE
HGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALSERFSVVDGYLYTVGSWMEGDSVDMT
RFPKLADYLARVGARPAVQRALAEMNG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctggaccttctataccgcccctggcacctgtgcgctggcgacgcacatcgcg
ctgcacgaagccggcgccgatttcgatcgggtcaagctggatttcggcgccacgcagcag
caaagccccgactacctgcgcgtcaaccccaagggccgcgtgccggcgctggccaccgaa
catggcgtgctgaccgagaatcccgccctgctcgctttcatcgcgcagagctttccgcag
gcgcagctggcgccgctgggcgatccgttcgcgttcgcgcgcatgcaggaactggccaac
tacctggcctccaccgcgcacgtcgcgcacgcgcacaaacggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaggccatgcgcgccaagatccccgagaacatgacggccatc
gccggctacctggaatcgcagatcgtcggtccctgggcactgagcgagcgcttcagcgtg
gtcgacggctatctgtacaccgtcggcagctggatggaaggcgacagcgtcgacatgacg
cgctttcccaagctggccgactacctggcgcgcgtcggcgcgcggccggccgtgcagcgc
gcgctggccgagatgaacggctga

DBGET integrated database retrieval system