KEGG   Bordetella parapertussis Bpp5: BN117_2622Help
Entry
BN117_2622        CDS       T02297                                 

Definition
(RefSeq) glutathione transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bpar  Bordetella parapertussis Bpp5
Brite
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN117_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 13890659
NCBI-ProteinID: YP_006896481
UniProt: K0MGV8
Position
2811828..2812613
Genome map
AA seq 261 aa AA seqDB search
MDMARPRGATRYHDGCPPAPPGIRSGRAMIDLYYWTTPNGHKITLFLEETGLPYRIHPVN
ISKGEQFQPEFLAIAPNNRIPAIVDQAPADGGAPIPLFESGAILLYLAEKTGQFIPADLR
GRADVLQWLFWQMGGLGPMAGQNHHFSAYAPERIPYAIERYVKETNRLYGVLDRQLAQRE
FVAGDYSIADMAAYPWIVPHERQGQDLNEFPNLKRWFEAIGARPATQRAYALADRINTKP
SVDTEESRRVLFGQTAANVRR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggacatggcgcgcccgcgcggcgcgacccgctatcatgacggctgcccgccggctccg
cccggcattcgctcaggacgcgccatgatcgatctctactactggacgactcccaacggc
cacaagatcacgctctttctcgaagagaccggcctgccttaccgcatacaccccgtcaac
atcagcaagggcgagcagttccagccggaattcctggccatcgcgcccaacaaccgcatc
ccggccatcgtcgaccaggcgccggccgatggcggcgcaccgatcccgctgttcgagtcc
ggcgccatcctgctgtacctggccgagaagaccggccaattcatccccgccgacctgcgc
gggcgcgccgacgtgctgcagtggctgttctggcagatgggcggactgggccccatggcc
ggccagaaccaccacttctcggcctatgcgcccgagcgcatcccctacgccatcgagcgc
tacgtcaaggaaaccaaccgcctgtatggcgtgctcgaccgccagctggcgcagcgcgag
ttcgtcgccggcgactactcgatcgccgacatggcggcctatccctggatcgtgccgcac
gagcgccagggccaggacctgaacgagtttccgaacctcaagcgctggttcgaggccatc
ggcgcccgcccggccacgcagcgcgcctacgcgctggccgaccggatcaacaccaagccg
tcggtcgacaccgaggagtcccgccgcgtgctgttcggccagaccgccgccaacgtgcgc
cgctga

DBGET integrated database retrieval system