KEGG   Bordetella parapertussis Bpp5: BN117_2754Help
Entry
BN117_2754        CDS       T02297                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpar  Bordetella parapertussis Bpp5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2976427..2977116)
Genome map
AA seq 229 aa AA seqDB search
MPRAPAQPAPLASGNLGLNSDRLRQAMVQRLRTQGIVDERVLNAMAAVPRHLFVDEALAS
RAYEDAALPIGHSQTISQPWVVARMIAAVCEDRAPARVLEVGAGCGYQAAVLAQIVREVH
AIERIRGLYELARGHLRALRLATRVRLIHGDGMLGVPGVAPFDAIVVAAAGLAIPQALLD
QLAPGGRLIAPEGSTHQRLVLIERTGATAWSRKELEAVRFVPLRAGIQS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgcgcgcctgcgcagcccgcgccgctggccagcggcaacctgggcctgaactcc
gaccggctgcgccaggcgatggtgcagcggctgcgcacgcagggcatcgtcgacgaacgg
gtgctcaacgccatggcggcggtgccgcgccatctgttcgtcgatgaagcgctggccagc
cgtgcctacgaagacgcggcgctgcccatcgggcactcgcagaccatttcgcagccgtgg
gtggtggcccgcatgatcgccgccgtctgcgaggaccgtgccccggcccgggtgctcgag
gttggcgccggctgcggctaccaggcggcggtactggcccagatcgtgcgcgaggtgcat
gccatcgagcgcatccgcggcctgtacgagctggcgcgcggccatctgcgggcgctgcgc
ctggccacccgggtgcgcctgatccatggcgacggcatgctgggcgtgcccggcgtggcg
ccgttcgatgctattgttgtggctgcggcgggcctggccattccgcaggccttgctggat
cagcttgcgccgggcgggcggctgatcgcgcccgaagggtccacccaccagcggctggtg
ctgatcgaacgcaccggggccaccgcctggagccgaaaagaactcgaagctgtacgtttt
gtgcccctcagggccggaatacaatcttga

DBGET integrated database retrieval system