KEGG   Bordetella parapertussis Bpp5: BN117_2813Help
Entry
BN117_2813        CDS       T02297                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpar00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3035014..3035832)
Genome map
AA seq 272 aa AA seqDB search
MARRNRMESMMSSSYTVQDKDVLRARVDREIESRVSEPQWTRAQKMALACRMLAEQGHWH
GGLAGQITARGDEPGTYWTLPFGVGADEARASELILIDEDLNPLDGKSLPNPANRFHIWI
YRHRPNVQCIVHTHPPAVSALSMVGEPLVVAHMDATPFYNDCAYLPQWPGLPIGDNEGEV
ISAALGEKRAILLANHGLLTAGSSIEESAVMALWMEQAAMLQLRARAIGPVKAVPGELAQ
ESHDFLVKPKIQSLTFAYFARRVLRAAPDCLD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaggcggaaccgaatggaaagcatgatgtcgtcttcttacacagtgcaggacaag
gatgtattgcgcgcgcgcgtcgaccgcgaaatcgagtcgcgcgtgagcgagccgcaatgg
acgcgcgcccagaaaatggcgctggcctgccgcatgctggccgagcagggccactggcat
ggcgggctggccggccagatcacggcgcgcggcgacgagccgggcacgtactggacgctg
ccgttcggcgtgggcgccgacgaggcgcgcgccagcgaactgatcctgatcgacgaggac
ctcaatccgctcgacggcaaatcgctgcccaatcccgccaatcgcttccacatctggatt
taccggcaccggcccaacgtgcagtgcatcgtccatacccatccgccggccgtctcggcg
ctgtcgatggtgggcgagccgctggtggtggcgcatatggacgccacgccgttctacaac
gattgcgcctatctgccgcaatggccgggcctgcccatcggcgacaacgagggcgaggtg
atttcggccgcgctgggcgagaagcgcgccatcctgctggccaaccatggcctgttgacc
gccggcagttcgatcgaggaatccgccgtcatggcgctgtggatggagcaggcggcgatg
ctgcaattgcgcgcgcgcgccatcgggccggtcaaggcggtgccgggcgaactggcgcag
gaatcacacgacttcctggtcaagcccaagatccagtcgctgacctttgcctatttcgcg
cggcgcgtgctgcgggccgcgcccgactgcctggattga

DBGET integrated database retrieval system