KEGG   Bordetella parapertussis Bpp5: BN117_3091Help
Entry
BN117_3091        CDS       T02297                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bpar01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bpar00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3328013..3329335)
Genome map
AA seq 440 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTILLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEHGGQAVKAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaacttgcagaaagactgggccgagaacacccgc
tggcagggcatcaagcgcgcctacagcgccgaggatgtgatccgcctgcgcggctcggtg
gccgtcgagcattcgctggcgcgccgcggcgcgacccgcttgtgggattcgttgcatagc
gagcccttcgtcaattcgctgggcgcgttgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtccggctggcaggtggccggcgacgccaacctggcc
ggcgagatgtacccggaccagtcgctgtaccccgccaactcggtgccgcaggtggtgcgc
cggatcaacaacgccctggcgcgttgcgaccagatccagtggatggaaggcaagaacccg
ggcgaccaggactacatcgattactatgcgcccatcgtggccgatgccgaggccggtttc
ggcggcgtgctcaatgccttcgaactgatgaaggccatgatcgaggcgggcgcggccggc
gtgcacttcgaagaccagctggcttcggtgaagaagtgcggccacatgggcggcaaggtg
ctggtgccgacccgcgaggccgtgtccaagctggtctcggcccgcctggccgccgacgtg
atgggcacgcccaccatcctgctggcccgcaccgacgccgacgcggccgacctggtgacc
agcgacgtggatgagaacgatcgtccgttcatcaccggcgagcgcacggtggaaggcttc
ttccgcacccgcgccggcctggaccaggcgatttcgcgcggcctggcctacgcgccgtat
gccgacctgatctggtgcgaaacctccacgcccaacctggagtatgcgcgcaagttcgcc
gaggccgtccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcacgatcgccaagttccagcgcgaactcggtgcg
atgggctacaagttccagttcatcacgctggccggtttccacgcgctgaactacggcatg
ttcgaactggctcacggttatgcgcgccgccagatgagcgctttcgtggagctgcagcag
aaggaattcgccgccgccgagctgggctttaccgcggtcaagcaccagcgcgaagtcggc
accggctacttcgacgccgtgacccagacgatcgaaggcggccagtcctcgaccacggcc
ctgaccggctcgaccgaggaagcgcagttcgagcacggcgggcaggccgtcaaggcggcg
tga

DBGET integrated database retrieval system