KEGG   Bordetella parapertussis Bpp5: BN117_3096Help
Entry
BN117_3096        CDS       T02297                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN117_3096 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BN117_3096 (nagZ)
Enzymes [BR:bpar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN117_3096 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3334303..3335364)
Genome map
AA seq 353 aa AA seqDB search
MSSKKKTKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTRA
IHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDPLAAMRLATEAGYVLA
AELRACGVDLSFTPVLDLDYGVSKVIGNRAFHHDARVVTMLSRALAQGLALAGMAACGKH
FPGHGFVGADSHQEIPVDPRPLARILKDDAAPYAWLGDLVMPAVMPAHVIYPKVDAQPAG
FSRRWVSEILRERLGYDGVVFSDDLTMEGASVAGDILARAEAALGAGCDMVLVCNRPDLA
DELLDRLQVQHPAASVERIRRLMPRFAAPDWDTLQNDSRYQHARRLQSQIVSG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagaagaaaaccaagcccgtcctgcctcccggccccgtcatggtggatgtg
gccggcacgacgctgaccaaggacgagaagcgccgcctgcgcaaccccctggtgggcggg
gtgatcctgttcgcgcgcaatttcaccgatcgccggcaattgtgcgcgctgacgcgggcc
atccacaaggcgcgcaaggagccgctgctgatcgcggtggaccacgaaggcggccgcgtg
cagcgctttcgcgacgacggctttaccgcgttgccgcccatgcaggagctgggcaagctg
tgggaccgcgatccgctggcggcgatgcggctggcgaccgaggccggctacgtgctggcc
gccgagctgcgcgcctgcggcgtcgatctcagcttcacgccggtattggacctcgactac
ggcgtgagcaaggtgatcggcaatcgcgccttccaccatgacgcgcgcgtggtcaccatg
ctgtcgcgcgcgctggcgcagggcctggcgctggcgggcatggcggcctgcggcaagcat
ttccccggccatggtttcgtgggcgccgattcgcaccaagagatcccggtcgatccgcgg
ccgctcgcgcgcatcctgaaggatgacgcggcgccttacgcctggctgggcgacctggtc
atgccggctgtcatgccggcgcatgtgatctatccgaaggtcgatgcccagcccgcgggt
ttttcgcgccgctgggtcagcgagatcctgcgcgaacggctgggctacgatggcgtggtg
ttctccgacgatctgaccatggagggcgcgtcggtggcgggcgacatcctggcccgcgcc
gaggcggccctgggcgccggctgcgacatggtgctggtatgcaaccgcccggacctggcc
gacgagctgctggaccgcctgcaggtccagcatccggccgcctcggtcgagcgcatccgc
cggctgatgccgcggttcgccgcgccggactgggacactttgcagaatgacagccgctat
cagcatgcccgacgacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system