KEGG   Bordetella parapertussis Bpp5: BN117_3193Help
Entry
BN117_3193        CDS       T02297                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00020  Citrate cycle (TCA cycle)
bpar00190  Oxidative phosphorylation
bpar00650  Butanoate metabolism
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01200  Carbon metabolism
Module
bpar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN117_3193 (sdhD)
   00650 Butanoate metabolism
    BN117_3193 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN117_3193 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Bap31 CybS
Motif
Other DBs
NCBI-GeneID: 13891230
NCBI-ProteinID: YP_006897003
UniProt: K0MKZ9
Position
complement(3446608..3446991)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgttggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system