KEGG   Bordetella parapertussis Bpp5: BN117_4146Help
Entry
BN117_4146        CDS       T02297                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN117_4146
Enzymes [BR:bpar01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     BN117_4146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4455618..4456643
Genome map
AA seq 341 aa AA seqDB search
MLHLAKFPRIKLGHFPTPLEFMPNLTRHLGGPNLYIKRDDCTGLATGGNKTRKLEFLVAQ
AVAQGADTLITQGAVQSNHARQTAAAAARVGMKCKILLEERVPHPDDDYSHSGNVMLDGL
MDGEIVARLPAGTDMQQAMEDLARELAGRGSKPYVIAGGGSTPVGALGYVACAQELLHQS
FETGLRIDHVVHATGSAGTQAGLVVGLRAGNSGIPVYGISVRAPKPRQEENVWKLVQSTV
DYMGLPASAVERADVVANSDYVGEGYGISTDAMIEAVHMTAALEAILLDPVYSGKGMAGL
IGLIRSGHFKQGENVVFVHTGGAVGLFGYRRAFEGLPPLAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctacatcttgccaagtttccccgcataaaactcgggcacttccccaccccgctcgaa
ttcatgcccaacctgacccgccacctgggcggaccgaacctctacatcaagcgcgacgac
tgcaccggcctggccaccggcggcaacaagacgcgcaaactggagtttctggtggcccag
gccgttgcgcaaggggcggatacgctgatcacccagggcgccgtccagtccaaccacgcg
cgccagaccgccgcggccgccgcgcgcgtcggcatgaagtgcaagatcctcctggaagag
cgtgtcccgcatccggacgatgactactcccactccggcaacgtcatgctcgacggcctg
atggacggcgagatcgtcgcgcgcctgcccgccggcaccgacatgcagcaggccatggaa
gacctggcccgcgaactggccgggcgcggcagcaagccctacgtcatcgccggcggcggc
tcgaccccggtcggcgcgctgggatacgtggcctgcgcgcaggagctgctgcaccaatcg
ttcgaaaccgggctgcgcatcgaccatgtcgtgcacgcgaccggcagcgccggcacgcag
gccgggctggtggtcgggctgcgcgccggcaacagcggcattccggtctacggcatcagc
gtgcgggcgcccaagcccaggcaggaagaaaacgtctggaagctggtgcagtccacggtc
gattacatgggcctgcccgccagcgcggtggagcgcgccgacgtggtggccaattccgac
tacgtcggcgagggatatggcatctccaccgacgcgatgatcgaggcggtgcacatgacc
gccgcactggaagccatcctgctggaccccgtctactcgggcaaaggcatggccggcctg
atcggattgatccgttcgggtcatttcaagcagggcgagaacgtagtgttcgttcacacg
ggaggcgcagtaggcctgttcggttaccgccgcgcattcgaaggcctgcctccattggcc
gcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system