KEGG   Bordetella parapertussis Bpp5: BN117_4220Help
Entry
BN117_4220        CDS       T02297                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpar  Bordetella parapertussis Bpp5
Brite
Enzymes [BR:bpar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BN117_4220 (dsbC)
Secretion system [BR:bpar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BN117_4220 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4532237..4533076)
Genome map
AA seq 279 aa AA seqDB search
MSGPPFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGTAPAKPGDK
VYSTRSAQAPDPQADAVKERFAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVM
EGPLIDALTRRDVTRERQEKLSSVPFDELPLDLAVKQVKGDGSRVMAVFEDPNCGYCKQL
HRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
EQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgggccgccgttttcaggagcaggtatgaatttccggatcacagtctggtgcgcc
gccgccgcggtgtggagctcgggcgccctggcgcaggatggtgccggccaggccgccccg
ggcacgccggacaaggtctactcgaccaccgggactgcgcccgccaagccgggcgacaag
gtgtattccacccgttcggcgcaggcgcccgatccgcaggccgacgcggtcaaggagcgg
ttcgcgcagcgcttcgaggggttcgacgtgacggcggtgcgacgcaccccgtacggactg
ttcgaagtgcagatcggaacggatctgctgtacaccgatgaaaaggtaacctgggtcatg
gaagggccgctcatcgacgccctgacccggcgcgatgtcacgcgcgagcgccaggaaaaa
ctgtccagcgtcccgttcgacgagttgccgctggacctggcggtcaagcaggtcaagggc
gatggttcgcgcgtgatggccgtattcgaggatccgaactgcggctattgcaagcaactg
caccgcacgctggaggacatggacaacatcacggtctacaccttcctgtatccgatcctc
tcgccggactcgacgaccaaggtgcgcgacatctggtgcgcctcggatcccgccaaggtc
tggaaagactggatggtgcgcggccagcgtccgcccaccgccgagtgcgatgcgccggtc
gagcaatggctggcgctgggccgccagttgatggtgcgcggcacgcccgcgattttcttc
aagagcggcggccgcgtcagcggcgcgctgccgcgcgacgaactcgaagcgcgtctgtag

DBGET integrated database retrieval system