KEGG   Bordetella parapertussis Bpp5: BN117_4229Help
Entry
BN117_4229        CDS       T02297                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01130  Biosynthesis of antibiotics
bpar01230  Biosynthesis of amino acids
Module
bpar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN117_4229 (trpC)
Enzymes [BR:bpar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BN117_4229 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-GeneID: 13892266
NCBI-ProteinID: YP_006897958
UniProt: K0MNZ4
Position
4540949..4541737
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKISQGKAGVIAEI
KKASPSKGVLRENFDPAEIAASYAMHGAACLSVLTDVQFFQGSHDNLRRARAACSLPVLR
KDFIIDPYQIISARAMGADCVLLIVAALAPAQLRDLETLAIDLGMDVLVEVHDAKELDAA
LALRTPLIGINNRNLRTFETTLQTTLDLLPMIPAGKRVVTESGILKPEDVRLMREHDVQA
FLVGEAFMRANDPGVELARLVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgcgaaaatcctcgccgtcaaggccgaggaagtggctaccgcacgg
cagatgcgcagcgaggccgaattgctgcgcgaagcccaggcgcgccaggatgtacgcggc
tttgcccaggccatcgaggacaagatcagccagggcaaggcgggcgtcatcgcggaaatc
aagaaagcctcgccttccaagggcgtgctgcgcgaaaacttcgacccggccgagatcgcg
gcgtcctatgccatgcatggcgcggcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggctcgcacgacaacctgcgccgtgcgcgcgcggcctgctcgctgcccgtgctgcgc
aaggacttcatcatcgatccttaccagatcatttcggcgcgcgccatgggcgcggactgc
gtcctgctcatcgtcgcggcgctggcgccggcgcagctgcgcgatctggaaaccctggcc
atcgacctgggcatggacgtgctggtggaagtgcacgacgccaaggagctggacgccgcg
ctggcgctgcgcaccccgctcatcggcatcaacaaccgcaacctgcgcaccttcgagacc
accctgcagacgacgctggacctgctgccgatgattccggccggcaagcgcgtggtcacc
gaaagcggcatcctcaagcccgaggatgtcaggctgatgcgcgagcacgacgtacaggcc
ttcctcgtcggcgaggccttcatgcgcgccaacgacccgggcgtcgaactggcgcggctg
gtggcctga

DBGET integrated database retrieval system