KEGG   Bordetella parapertussis Bpp5: BN117_4229Help
Entry
BN117_4229        CDS       T02297                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpar01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bpar00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4540949..4541737
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKISQGKAGVIAEI
KKASPSKGVLRENFDPAEIAASYAMHGAACLSVLTDVQFFQGSHDNLRRARAACSLPVLR
KDFIIDPYQIISARAMGADCVLLIVAALAPAQLRDLETLAIDLGMDVLVEVHDAKELDAA
LALRTPLIGINNRNLRTFETTLQTTLDLLPMIPAGKRVVTESGILKPEDVRLMREHDVQA
FLVGEAFMRANDPGVELARLVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgcgaaaatcctcgccgtcaaggccgaggaagtggctaccgcacgg
cagatgcgcagcgaggccgaattgctgcgcgaagcccaggcgcgccaggatgtacgcggc
tttgcccaggccatcgaggacaagatcagccagggcaaggcgggcgtcatcgcggaaatc
aagaaagcctcgccttccaagggcgtgctgcgcgaaaacttcgacccggccgagatcgcg
gcgtcctatgccatgcatggcgcggcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggctcgcacgacaacctgcgccgtgcgcgcgcggcctgctcgctgcccgtgctgcgc
aaggacttcatcatcgatccttaccagatcatttcggcgcgcgccatgggcgcggactgc
gtcctgctcatcgtcgcggcgctggcgccggcgcagctgcgcgatctggaaaccctggcc
atcgacctgggcatggacgtgctggtggaagtgcacgacgccaaggagctggacgccgcg
ctggcgctgcgcaccccgctcatcggcatcaacaaccgcaacctgcgcaccttcgagacc
accctgcagacgacgctggacctgctgccgatgattccggccggcaagcgcgtggtcacc
gaaagcggcatcctcaagcccgaggatgtcaggctgatgcgcgagcacgacgtacaggcc
ttcctcgtcggcgaggccttcatgcgcgccaacgacccgggcgtcgaactggcgcggctg
gtggcctga

DBGET integrated database retrieval system