KEGG   Bordetella parapertussis Bpp5: BN117_4400Help
Entry
BN117_4400        CDS       T02297                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN117_4400 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    BN117_4400 (hisD)
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BN117_4400 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4721355..4722677
Genome map
AA seq 440 aa AA seqDB search
MQYHDAMALINRLDSRDPGFKTALSQLLAFEAEQDESIDQAAAGILADVRRRGDAALLEY
TQRFDRLAVDDATALEIPQADWHAALDSLPAAQRQALEAAAARVRAYHERQRGETWTYTE
ADGTMLGQQITALDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVPELIMVTPTPDGVRNPI
VLAAAAIAGVDRAFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRVFGTVGID
MIAGPSEILVICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAFLAEVEAAIERLLPG
MPRADILRVSLANRGALILVRDLEEACAIANDIAPEHLEISTEQPQRWTALIRHAGAIFM
GRYSSEALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSREGAQTLGRIAAEL
ALGEGLQAHAASAQYRLDQP
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtaccatgacgccatggccttgatcaatcgtctcgactcccgcgatcccgggttc
aaaaccgccctgtcccaattgctggccttcgaggccgagcaggacgaatccatcgaccag
gccgccgccggcatcctggccgacgtgcgccgccgcggcgacgccgcgctgctcgaatac
acccagcgcttcgaccgcctggccgtcgacgacgccacggccctggaaatcccccaggcc
gattggcatgcggcgctggattcgctgccggccgcccagcgccaggcgctggaagccgcc
gccgcgcgcgtgcgcgcctatcacgagcgccagcgcggcgagacctggacctacaccgag
gccgacggcaccatgctgggccagcagatcacggcgctggaccgcgtcggcctgtacgtg
cccggcggcaaggccgcctatccgtcgtcggtgctgatgaacgccattccggccaaggtt
gccggcgtgcccgagctgatcatggtcacgcccacgccggacggcgtgcgcaaccccatc
gtgctggccgccgccgccatcgccggcgtggaccgcgccttcgccatcggcggcgcccag
gccgtcggcgcgctggcctacggcaccgccacggtgccggcggtcgacaagatcgtcggc
ccgggcaacgcctatgtcgccgccgccaagcggcgcgtcttcggcaccgtcggcatcgac
atgatcgccggcccgagcgaaatcctggtgatctgcgacggcaagacgccggccgactgg
atcgccatggacctgttctcgcaggccgagcacgacgaactggcccagtccatcctgctc
tgtcccgacgccgccttcctggccgaggtcgaggccgccatcgaacgcctgctgccgggc
atgccgcgcgccgacatcctgcgcgtcagcctggccaaccgcggcgcgctcatcctggtg
cgcgacctcgaagaggcctgcgccatcgccaacgacatcgcccccgaacacctggagatc
tccaccgagcagccgcagcgctggaccgccctgatccgccacgcgggcgcgatcttcatg
ggccgctacagctcggaggcgctgggcgactactgcgccggccccaaccacgtcctgccg
acctcgcgcacggcgcgcttctcgtcgccgctgggcgtgtacgacttccagaagcgctcc
agcctgatccaggtctcgcgcgagggcgcccagacgctggggcgcatcgccgccgaactg
gccctgggcgaaggcctgcaggcccacgccgccagcgcccagtaccggctcgaccagcca
tga

DBGET integrated database retrieval system