KEGG   Butyrivibrio proteoclasticus: bpr_I0008Help
Entry
bpr_I0008         CDS       T01292                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bpr_I0008 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I0008 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bpr_I0008 (trpA)
Enzymes [BR:bpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bpr_I0008 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(10411..11178)
Genome map
AA seq 255 aa AA seqDB search
MSKIKTAFENGKAFIAFITCGDPDLETTKEAVIAAVKGGADLIELGIPFSDPTAEGPVIQ
GANLRALNGGITTDKIFEFVKDLRKSVSVPMVFMTYANVVYSYDSEKFIKICSEIGMDGL
ILPDLPFEEKEEFEDTCNKYDIDLVSLIAPTSEKRISMIAREAKGFIYVVSSLGVTGTRS
SITTDLDSIVKVIRENTDIPCAIGFGISTPEQAAKMSNISDGAIVGSAIIKLLEKHGKNA
PKYIEDYVHEMKAAM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaaacagcttttgaaaatggcaaagcttttatagcctttatcacatgc
ggagatccagaccttgaaacaactaaggaagctgtcattgcagcagtaaagggaggagct
gaccttatagagcttggcatacctttttctgatccaacagccgaaggccccgttattcag
ggtgctaatcttcgcgcattaaacggaggcatcactacagataagatttttgaattcgtt
aaagatctacgaaagagcgtttcagttcctatggtttttatgacttacgcaaatgtagtt
tattcctacgattcagaaaagtttatcaaaatatgcagtgaaattggtatggatggactt
attttacctgatcttccttttgaggagaaagaggaatttgaagatacctgcaataaatat
gacatagaccttgtctcgttaatagcaccaacttcagaaaaaagaatatctatgattgcc
agagaagctaaaggctttatctatgtagtttcaagtcttggcgtaacaggtaccagaagc
agtattactactgatcttgattctattgttaaagtaattcgcgaaaacactgatattcca
tgtgctatcggatttggtatttctacacctgaacaggctgctaaaatgtccaatatctca
gacggcgcaattgttggctctgctattatcaagctgttagaaaaacatggtaaaaacgcc
ccaaaatacatcgaagattatgtacatgaaatgaaagcagctatgtga

DBGET integrated database retrieval system