KEGG   Butyrivibrio proteoclasticus: bpr_I0009Help
Entry
bpr_I0009         CDS       T01292                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta subunit TrpB1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00260  Glycine, serine and threonine metabolism
bpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01130  Biosynthesis of antibiotics
bpb01230  Biosynthesis of amino acids
Module
bpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I0009 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bpr_I0009 (trpB1)
Enzymes [BR:bpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bpr_I0009 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL32761
UniProt: E0S2D8
Position
1:complement(11201..12391)
Genome map
AA seq 396 aa AA seqDB search
MSKSRGRFGVHGGQYIPETLMNAVIELEEAYNHYKNDPEFNRELSELLNEYAGRPSRLYY
AEKMTRDLGGAKIYLKREDLNHTGAHKINNVLGQALLAKKMGKTRLIAETGAGQHGVATA
TAAALMGMECVVFMGEEDTKRQALNVYKMKLLGAEVIPVTSGTATLKDAVSEAMREWTSR
IDDTHYCLGSVMGPHPFPTIVRDFQAVISKEIKEQMLEKEGRLPDAVIACVGGGSNAIGS
FYNFIDDESVRLIGCEAAGRGIDTFETAATINTGRLGIFHGMKSYFCQDEYGQIAPVYSI
SAGLDYPGIGPEHAYLHDIHRAKYVAITDDEAVNAFEYLSKTEGIIPAIESSHALAYAIK
LAPTMDKDKIIVVTISGRGDKDCAAIARYRDENISD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtccagaggaagatttggtgttcacggaggtcagtatatacctgaaactctt
atgaatgctgtgatagaacttgaagaagcctacaaccattacaaaaatgatcctgaattt
aacagagaactatctgagctgttaaacgagtatgcaggtcgtccttcaagattatattat
gctgagaaaatgacaagagaccttggtggagcaaagatttatctcaaaagggaagatttg
aaccataccggagctcacaagatcaacaatgtccttggtcaggctcttttggccaaaaaa
atgggcaagaccagactcatagctgaaaccggcgcaggtcagcacggcgtagctactgca
actgctgcggccttaatgggaatggaatgtgttgttttcatgggtgaagaggacactaag
agacaggcgcttaatgtctacaagatgaagcttcttggcgctgaggttatccctgtaaca
tccggaaccgctactcttaaggatgcagtttctgaagccatgagagagtggacttcaagg
attgatgatactcattattgcctcggctctgttatgggaccacatccatttcctactata
gtcagagattttcaggcagtaatctccaaagagatcaaagaacaaatgctggaaaaagag
ggtagactccccgatgctgttattgcctgtgttggaggcggctctaatgctataggatcc
ttttacaattttattgacgatgaatcagtacggttaatcggatgtgaagcggccggaaga
ggcattgatacctttgaaactgctgcaactatcaacaccggaagacttggtattttccac
ggcatgaaatcttatttttgtcaggatgaatatggacagattgctcctgtttattcaatt
tcagccgggcttgattaccctggaatcggaccggagcatgcctaccttcatgatattcac
agagccaaatacgttgctataacagatgatgaggcagtaaatgcatttgaatatctctcc
aaaactgaaggaattattcctgctatagaatcttctcatgctcttgcatacgctattaaa
cttgctcctacaatggataaagacaagatcatcgttgtaactatttccggaagaggagat
aaagactgcgctgcgattgcacgctatagagacgaaaatatttcagattga

DBGET integrated database retrieval system