KEGG   Butyrivibrio proteoclasticus: bpr_I0026Help
Entry
bpr_I0026         CDS       T01292                                 

Gene name
xyn10B
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bpb  Butyrivibrio proteoclasticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:33228..36929
Genome map
AA seq 1233 aa AA seqDB search
MHKRWLGISSFVMAGLLTVTNVGTGVTQVFAAEAATGSSLVAEVEEAAVEESSAETSVED
AADEASSEASVAEEATEESSDESAKEATDEASAETSAEPAEEENSLVFFNRWNQSAKTSG
KLVFSKQYEEYCYDLGETVPVANVKALTVKVSKQDKNVAIKLYDADMTEKYANYGCDKNC
EYVFNPTYDGNVRYIGVMSMASGEAEYPYGITIDEVVVDKQETEAPKNEETIVLEGDALK
FTEAWEGTEVDGATLEFDKEWREYRVSLGKTLPGPDVKSVKVTFAEANKQSICIKTYGGG
TELKADYGKNGSKSYTTYPNVTADVDAIAIMAMNEQTYPFSVTVEKIEVVVDTTPAEDRP
QAGVEYDIVDLRKPVAELMGDDFIIGTAASYDEFGDPLDMELVYKHFNGVTLGNELKPDS
MLRKDAEIVDYELNGEMVPFPVLDFSRPEDRLDRFVKWNEEHPEKKIQVRGHVLVWHSQT
PSFFFHEDYDTSKPYVTPDVMNKRLEIYIREVAKHFTAEDSKYKDLFYGWDVVNEAVSDG
TGTYRNASERSEWWGVYGSQEFITNAFVYANRYMPADIALFYNDYNETVSSKMGGICQLL
RDVKATPGARIDGMGMQAHYQIASNNPSMEQFKTAAKAYAAIVDQVQVTELDFKGATSAK
DDRLAERYKAVYDTIRRLREDGVNFTGMTIWGVTDKHSWLQSSNNNGGGADGSARQYPLL
FDDYYKAKDCFWAIANAGELEPEVKSITLVQNVNNDFSAGNVYEFVAGKFIPMWSENGID
VKVVIKDTTTGQDDFFTVYADDGTGIKSVVVKREEATENENGYEAVVNVPVDFEALTANK
VKFDIVVNDGDFLAVFNDTTFKHAQSSKFFAETVIKPLAVVKKGTPVIDGEFDDEAWKTA
DELPVAIKVGAKASASAKILWDDEYLYVLADVKDSVLNKASSDAWEQDSVEIFVDENNNK
TSTYEADDKQYRINFENTHSFNGTKCVEENIKSEVVVTEDGYKIEAALKWTDIAPVEGAK
VGLDIQVNDADNSGKRVGTLNWADKTGNGWSSTEVFGTILLADGSDVPTPEVPTPETPEE
PEGTLVTKYGKTYVVTANGEKLTGLQKVDGNMYYCKADGKVSKNALFTFEGAVYCAGADG
VLARNVKLEKYHNEYFFGDDCKAKTGFVTYDGQDYFCKDNGRVAKDYMITVGDKKYYAKK
DGTLAKNEQIVKLFRRYTFDENGVLIKTEKGIF
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaagatggttggggatatcatcgtttgttatggcaggtcttttaactgtaaca
aatgttggtaccggtgtaacacaggtatttgctgcagaagcagcaactggtagctcactg
gttgctgaagtggaagaagcagcagtagaagaaagttcagctgagacaagtgtagaagat
gctgctgatgaggcttcttctgaggcttcagtggctgaagaagctacagaggagtcttca
gatgaatctgcaaaggaagcaacagatgaggcttcagctgaaacatcagcagagccagct
gaagaagaaaatagtcttgttttctttaacagatggaatcagagtgccaagacttcagga
aagctcgttttttccaagcagtatgaggagtattgctatgatcttggagagacagttcca
gtagctaatgttaaggcacttactgtaaaagtttctaaacaggataagaacgttgcaatc
aagctctatgacgcagacatgactgagaagtatgcaaattatggctgtgataagaattgt
gaatatgtatttaatcctacatatgatggcaatgttagatatattggtgttatgtcaatg
gcatcaggagaagctgagtacccatatggcatcactattgacgaggttgttgttgataag
caggagacagaagctcctaagaacgaggagacaattgttcttgagggagatgcgcttaag
tttactgaggcatgggaaggtactgaagtagacggagcaactcttgagtttgacaaagag
tggcgtgagtacagagtttctcttggaaagacacttccgggacctgatgttaagtcagta
aaggttacatttgcagaagctaataagcagagcatctgcattaagacatatggaggcggt
acagagctcaaggctgactatggtaaaaatggcagcaagagctacacaacatatcctaat
gttacagctgatgttgatgcaattgctatcatggcaatgaatgaacagacatatccattt
agcgtaacagtagaaaagattgaagttgttgtagatacaactcctgcagaggacagacct
caggctggcgttgagtatgatatcgtcgacctcagaaagcctgtagcagagcttatgggt
gatgatttcatcatcggaacagcagcaagctacgatgagtttggcgatccacttgatatg
gagcttgtttacaagcacttcaatggagtaactcttggtaacgagcttaagcctgattca
atgctcagaaaagatgctgagatagttgattatgagctcaatggtgagatggttccattc
cctgttcttgatttctcaagacctgaggatcgtcttgacagattcgttaagtggaatgaa
gaacatcctgaaaagaaaatccaggtaagaggccatgttcttgtttggcattcacagact
ccttcattcttcttccatgaagattatgacacatccaagccttatgtaactcctgacgta
atgaataagcgtcttgagatctacatcagagaagttgctaagcacttcacagcagaagac
agcaagtacaaagatctcttctatggatgggatgttgttaacgaagcagtaagtgatgga
acaggtacttacagaaatgcatctgagagatcagagtggtggggagtttacggctcacag
gagttcatcacaaacgcattcgtatatgctaacagatatatgcctgctgatatcgctctt
ttctataacgattataacgagacagtaagcagcaagatgggtggtatctgccagcttctt
agagatgttaaggcaacacctggtgcaagaattgatggtatgggtatgcaggctcactac
cagattgcatccaacaatccttcaatggagcagttcaagacagcagccaaggcttatgca
gctatcgttgaccaggttcaggtaactgagcttgacttcaagggtgctacaagtgccaag
gatgacagacttgcggagagatacaaagcagtttatgacacaatcagaagacttagagaa
gacggcgtaaacttcacaggtatgacaatctggggagtaacagataagcattcatggctc
cagtcatcaaacaataacggtggcggcgcagacggaagcgcaagacagtatccacttctc
tttgatgattactacaaggctaaggattgcttctgggcaattgcaaatgccggagaactt
gagcctgaagtaaagtcaataacacttgtacagaatgtaaataatgatttctcagctggt
aatgtatatgagtttgttgctggcaagtttatccctatgtggagtgagaatggcatcgac
gttaaagttgtaataaaagatacaacaactggccaggatgatttctttacagtttatgca
gatgacggaacaggaatcaaatcagtagtagtaaagagagaagaagcaacagaaaatgaa
aatggatacgaggcagtagtaaatgttcctgttgactttgaagctcttacagctaacaag
gttaagtttgatattgtagttaatgacggtgatttccttgctgtatttaacgacacaaca
tttaagcatgctcagtccagcaagttctttgctgaaacagtaattaagccacttgcagta
gttaagaagggcacacctgttattgatggtgagtttgatgatgaagcctggaagacagca
gatgagcttcctgtagctatcaaagttggtgctaaggcatctgcaagcgccaagatcctt
tgggatgatgaatacctctatgtacttgctgatgttaaagattcagttctcaacaaggca
tcttcagatgcatgggagcaggattcagttgaaatctttgtagatgagaataacaacaag
acaagtacttatgaagcagatgacaagcagtacagaatcaacttcgagaatacacacagc
tttaatggtacaaagtgtgtagaagaaaacatcaagtctgaagtagttgttacagaagat
ggctacaagattgaagcagcacttaagtggacagacatagctcctgtagaaggtgctaag
gtaggccttgatattcaggttaacgatgcagacaactcaggcaagagagtaggaacactt
aactgggctgacaagactggtaatggctggtcatcaacagaagtatttggaacaattctt
cttgcagatggatcagatgttcctacaccagaagttcctacaccagagacaccagaagaa
cctgaaggaacacttgttaccaagtatggcaagacatatgtagttacagcaaatggcgag
aaactgacaggtcttcagaaagtagatggcaacatgtactattgcaaggctgatggtaag
gtttcaaagaatgcattatttacatttgagggtgcagtttactgcgcaggtgctgatggt
gttcttgcaagaaatgttaagcttgagaaatatcataacgaatatttcttcggcgatgat
tgcaaggcgaagactggctttgtgacatatgatggacaggattacttctgtaaggacaat
ggaagagttgccaaggactatatgatcacagttggtgacaaaaagtactacgcaaagaaa
gacggaacacttgctaagaatgagcagattgttaaactgttccgcagatacacatttgac
gagaacggtgttcttatcaagacagaaaaaggtattttctaa

DBGET integrated database retrieval system