KEGG   Butyrivibrio proteoclasticus: bpr_I0060Help
Entry
bpr_I0060         CDS       T01292                                 

Gene name
glgB1
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:71262..73181
Genome map
AA seq 639 aa AA seqDB search
MSQKVFISEDDEYLFGQGTHYDIYDKLGAHPSEEKGKKGFFFAVWAPNAADVHVVGDFNG
WDENAHQMKRSKTGNIWTLFIPGVAIGALYKFLITAQDGRKLYKADPYANYAELRPGNAS
RTTDLSGFKWSDSKWYESLKGKDMNRQPIAIYECHIGSWMKHPDGTEDGFYTYRQFADRI
VEYLKEMKYTHIELIGIAEHPFDGSWGYQVTGYYAPTARYGEPTDFMYLINQLHKHGIGV
ILDWVPAHFCPDEFGLACFDGTCIYEDPDPRKGEHPDWGTKIFNLAKPEVKNFLIANALY
WIRKFHIDGLRVDAVASMLYLDYGKKDGQWVPNKYGDNKNLDAIEFFKHFNSVVRGTYPN
ILTIAEESTAWPKVTAPPEEDGLGFAFKWNMGWMHDFCEYMKLDPYFRQGAHYMMTFAMS
YNDSENYILPLSHDEVVHLKCSMVEKMPGYKVDKYANLRVGYTYMFGHSGKKLLFMGQDF
GQEREWSEKRELDWFLLENDLNRGMKDYVGKLLEIYRKYPALYEVDNDWGGFEWINADDK
ERSTYSFYRRASNGKDNILFVLNMTPMERKGFKVGVPFDGTYTKILDSAKECYGGSGSSV
PDKIKAVKGLCDYKDYSIEFDLPPYGAEVFVFQTKKTKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaggtttttatatctgaggacgacgagtacttatttggacagggcacacat
tacgatatttatgataaattgggagctcatccatcagaagaaaagggcaaaaaaggattc
ttttttgcagtatgggcaccaaatgctgcagatgtgcatgtagtaggtgactttaatggt
tgggatgaaaatgcccatcaaatgaagaggagcaaaacaggtaacatctggactttgttc
attccgggagtagcaataggagctttatacaaattcctcattacagctcaggatggaaga
aagctttacaaggctgatccttatgcgaattatgcagaacttaggccgggtaatgcttcc
agaacaacagatctttcaggctttaagtggtcagattccaagtggtatgaatcacttaag
ggtaaagatatgaaccgtcagcctatagccatctatgaatgccatataggctcatggatg
aaacatcctgatggcacagaggacggtttctatacatatagacaattcgctgacagaatt
gtggaatacctcaaggagatgaagtatacacatatagagctgattggaatagctgagcat
ccttttgatggatcctggggctatcaggttactggctactatgcacctacagccagatat
ggcgagccaacagactttatgtatctgatcaaccagctccacaagcatggaatcggcgta
attctcgattgggttccggcccatttctgtccggatgaatttggtcttgcatgctttgac
ggaacatgtatttatgaagatccggatcctcgcaagggagaacatcctgactggggaacc
aagatattcaatctggccaagccggaagtcaagaacttccttatcgccaatgctttatac
tggatccgcaagttccatattgatggacttagggtagatgcagttgcttcaatgctctat
cttgattatggcaaaaaagatggacagtgggttccaaataaatatggagataacaagaac
ctcgatgctatcgagttctttaaacattttaacagcgtagtaaggggaacataccctaat
attctcactatagctgaggagtctacagcgtggcccaaggttactgctccgccagaggag
gatggtcttggttttgcgttcaagtggaacatgggatggatgcatgacttctgcgaatac
atgaagcttgatccatactttagacagggtgctcattacatgatgacttttgcaatgagc
tacaatgattcagagaattacattttgccattgtctcacgacgaggtcgtacaccttaag
tgctcaatggtagagaagatgccaggatacaaggttgataaatatgctaacctaagagtt
ggttatacctacatgtttggtcactcaggtaaaaagctcctctttatgggacaggatttt
ggtcaggaaagagaatggagcgagaagagagaacttgactggttcctcttggagaacgac
cttaacagaggaatgaaggactatgtaggtaaacttctggaaatatacagaaaatatcct
gctctctatgaagtagataatgactggggcggctttgagtggataaatgccgacgacaag
gagcgcagcacctatagtttctaccgtagggcatctaatggcaaggacaatattctcttt
gttcttaatatgacaccaatggagagaaagggctttaaggtaggtgttccatttgatgga
acctatacaaagattctcgacagtgccaaggagtgctatggcggcagtggcagtagcgtt
cccgataagatcaaggcagtaaaaggtctgtgtgattacaaggattacagcatagaattt
gatcttccgccttacggcgcagaagtatttgtttttcagacgaagaaaacaaagaattaa

DBGET integrated database retrieval system