KEGG   Butyrivibrio proteoclasticus: bpr_I0060Help
Entry
bpr_I0060         CDS       T01292                                 

Gene name
glgB1
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bpr_I0060 (glgB1)
Enzymes [BR:bpb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     bpr_I0060 (glgB1)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpr_I0060 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:71262..73181
Genome map
AA seq 639 aa AA seqDB search
MSQKVFISEDDEYLFGQGTHYDIYDKLGAHPSEEKGKKGFFFAVWAPNAADVHVVGDFNG
WDENAHQMKRSKTGNIWTLFIPGVAIGALYKFLITAQDGRKLYKADPYANYAELRPGNAS
RTTDLSGFKWSDSKWYESLKGKDMNRQPIAIYECHIGSWMKHPDGTEDGFYTYRQFADRI
VEYLKEMKYTHIELIGIAEHPFDGSWGYQVTGYYAPTARYGEPTDFMYLINQLHKHGIGV
ILDWVPAHFCPDEFGLACFDGTCIYEDPDPRKGEHPDWGTKIFNLAKPEVKNFLIANALY
WIRKFHIDGLRVDAVASMLYLDYGKKDGQWVPNKYGDNKNLDAIEFFKHFNSVVRGTYPN
ILTIAEESTAWPKVTAPPEEDGLGFAFKWNMGWMHDFCEYMKLDPYFRQGAHYMMTFAMS
YNDSENYILPLSHDEVVHLKCSMVEKMPGYKVDKYANLRVGYTYMFGHSGKKLLFMGQDF
GQEREWSEKRELDWFLLENDLNRGMKDYVGKLLEIYRKYPALYEVDNDWGGFEWINADDK
ERSTYSFYRRASNGKDNILFVLNMTPMERKGFKVGVPFDGTYTKILDSAKECYGGSGSSV
PDKIKAVKGLCDYKDYSIEFDLPPYGAEVFVFQTKKTKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaggtttttatatctgaggacgacgagtacttatttggacagggcacacat
tacgatatttatgataaattgggagctcatccatcagaagaaaagggcaaaaaaggattc
ttttttgcagtatgggcaccaaatgctgcagatgtgcatgtagtaggtgactttaatggt
tgggatgaaaatgcccatcaaatgaagaggagcaaaacaggtaacatctggactttgttc
attccgggagtagcaataggagctttatacaaattcctcattacagctcaggatggaaga
aagctttacaaggctgatccttatgcgaattatgcagaacttaggccgggtaatgcttcc
agaacaacagatctttcaggctttaagtggtcagattccaagtggtatgaatcacttaag
ggtaaagatatgaaccgtcagcctatagccatctatgaatgccatataggctcatggatg
aaacatcctgatggcacagaggacggtttctatacatatagacaattcgctgacagaatt
gtggaatacctcaaggagatgaagtatacacatatagagctgattggaatagctgagcat
ccttttgatggatcctggggctatcaggttactggctactatgcacctacagccagatat
ggcgagccaacagactttatgtatctgatcaaccagctccacaagcatggaatcggcgta
attctcgattgggttccggcccatttctgtccggatgaatttggtcttgcatgctttgac
ggaacatgtatttatgaagatccggatcctcgcaagggagaacatcctgactggggaacc
aagatattcaatctggccaagccggaagtcaagaacttccttatcgccaatgctttatac
tggatccgcaagttccatattgatggacttagggtagatgcagttgcttcaatgctctat
cttgattatggcaaaaaagatggacagtgggttccaaataaatatggagataacaagaac
ctcgatgctatcgagttctttaaacattttaacagcgtagtaaggggaacataccctaat
attctcactatagctgaggagtctacagcgtggcccaaggttactgctccgccagaggag
gatggtcttggttttgcgttcaagtggaacatgggatggatgcatgacttctgcgaatac
atgaagcttgatccatactttagacagggtgctcattacatgatgacttttgcaatgagc
tacaatgattcagagaattacattttgccattgtctcacgacgaggtcgtacaccttaag
tgctcaatggtagagaagatgccaggatacaaggttgataaatatgctaacctaagagtt
ggttatacctacatgtttggtcactcaggtaaaaagctcctctttatgggacaggatttt
ggtcaggaaagagaatggagcgagaagagagaacttgactggttcctcttggagaacgac
cttaacagaggaatgaaggactatgtaggtaaacttctggaaatatacagaaaatatcct
gctctctatgaagtagataatgactggggcggctttgagtggataaatgccgacgacaag
gagcgcagcacctatagtttctaccgtagggcatctaatggcaaggacaatattctcttt
gttcttaatatgacaccaatggagagaaagggctttaaggtaggtgttccatttgatgga
acctatacaaagattctcgacagtgccaaggagtgctatggcggcagtggcagtagcgtt
cccgataagatcaaggcagtaaaaggtctgtgtgattacaaggattacagcatagaattt
gatcttccgccttacggcgcagaagtatttgtttttcagacgaagaaaacaaagaattaa

DBGET integrated database retrieval system