KEGG   Butyrivibrio proteoclasticus: bpr_I0100Help
Entry
bpr_I0100         CDS       T01292                                 

Gene name
glk
Definition
glucokinase Glk (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bpr_I0100 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_I0100 (glk)
   00052 Galactose metabolism
    bpr_I0100 (glk)
   00500 Starch and sucrose metabolism
    bpr_I0100 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_I0100 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bpr_I0100 (glk)
   00524 Butirosin and neomycin biosynthesis
    bpr_I0100 (glk)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bpr_I0100 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:121777..122715
Genome map
AA seq 312 aa AA seqDB search
MARYVFGIDLGGTTAKIGLLTEGGEKVDFWEVPTRTENNGEFILADVADAIRAKMNERGI
DDSEVIGAGIGVPGAVNVDGLCYQAVNLGWENLNVVNELHSKLKLPVKAGNDANVAALGE
AWKGGGRGYQNMLLVTLGTGVGGGIINEGKILAGSKGSGGEIGHIHLEDEEPDACGCGNH
GCFEQYASATGAVRLARRILAATDEDSALRHIDNFQCKDVFDEAKKGDKVALQIAEKYGY
YLGKGIAITASVVNPEIIVLGGGVSRAGEMLFDLLKPSFEKYVFPGCKDVKFALAKLGND
AGVYGAAKMLLY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggctagatacgtattcggaatagatttaggcggaacaactgccaagatcggactgttg
acagaaggtggcgagaaggtagatttctgggaagttcctaccagaactgagaacaatgga
gagtttatccttgcggatgttgcagatgcaatcagagccaagatgaacgaaagaggaatc
gatgactcagaagtaatcggtgcaggaattggtgttcctggtgctgttaatgtagatggt
ctgtgctatcaggctgtaaaccttggatgggagaatctcaatgttgttaacgagcttcat
tccaagttaaagcttcctgtaaaagccggtaatgatgcaaacgtagcagctctcggcgaa
gcctggaagggcggcggacgcggctatcagaacatgcttctcgtaacacttggaacaggt
gttggcggaggaatcatcaacgaaggtaagattcttgccggttctaagggatcaggcgga
gaaattggtcatattcatcttgaggatgaagagcctgatgcatgcggatgcggtaaccac
ggctgttttgagcagtacgcaagcgcaacaggagctgtaagacttgccaggagaattctt
gcggcaacagacgaagacagcgcgcttagacatattgataatttccagtgcaaggatgta
ttcgatgaagccaagaagggtgataaggttgctcttcagattgctgaaaaatatggatat
taccttggaaaaggaattgctattacagcaagcgttgttaaccctgagatcattgttctt
ggtggcggcgtatcaagagccggagagatgctctttgatctcctgaagccaagctttgag
aaatatgtattccctggctgcaaggatgtcaagtttgctcttgctaagcttggaaatgac
gccggagtatatggcgcggccaagatgctgttgtattaa

DBGET integrated database retrieval system