KEGG   Butyrivibrio proteoclasticus: bpr_I0205Help
Entry
bpr_I0205         CDS       T01292                                 

Gene name
aga27A
Definition
(GenBank) alpha-galactosidase Aga27A
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00052  Galactose metabolism
bpb00561  Glycerolipid metabolism
bpb00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bpr_I0205 (aga27A)
  Lipid metabolism
   00561 Glycerolipid metabolism
    bpr_I0205 (aga27A)
   00600 Sphingolipid metabolism
    bpr_I0205 (aga27A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     bpr_I0205 (aga27A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C MVL Rep_Org_C
Motif
Other DBs
NCBI-ProteinID: ADL32954
UniProt: E0RW88
Position
1:261772..263556
Genome map
AA seq 594 aa AA seqDB search
MTPDRLEAEGRFDSFDNGKVLFGKKKYRLPAMGWNSWNAFGSGNTEELTKAMADKFIELG
LDKLGYKYIVLDDGCYKDQRVDGRLSNEDGKFPGGFRALSDYIHSKGLKFGMYNDIGTNL
CAGAEVGTCGHEKEDAENYLEWGVDFLKVDNCYYLWDNATFSNPENARYTFAPNIRGIRI
GAEEFPVIYGVHDGGEVSLAGIELTGERASREEDYITGIGTFDGTGPEASPVGLRSSELV
FVVNADRDMDTTLCVNYASGKREGVGAWLQVAVGDEYYWDDFLDETPSEGDFIWSREISI
KLKKGENRIRLMNHRRQENTLNSYARLLKKLNRLAPDNDIIYSACEWGKTQPQNWAYKVC
DSWRILNDITFRVGRDGDPGVGTWTGDYTTSVATQYSKAVIMDEFAGLDKGWNDPDMMMI
GMNGLNDVQNKTHMTMWCMMNSPLMLGLDLRRVHKGDTLYNIIANEDAISLNQDSLGIQA
KRVFSSLAAKEPDKEYIRDIDRVDILCKPLSGNRFALSFINVSEKDTDKTYTIKLCDLKK
ALGDWIYKCDKYLVKDIWTGETTENETGEFSVNGLAACDNVTFIVSPASPVEMK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggatagattagaggcagagggaagattcgactcatttgataatggaaaagta
ctatttgggaaaaagaaatacaggctcccggcaatgggctggaatagctggaatgctttt
ggcagtggaaatacagaggaacttaccaaggctatggcggataagtttatagaacttggc
cttgataagcttggatataaatacattgttcttgatgatggatgctacaaggaccaacgt
gtagacggaaggctgtccaatgaggatggcaagtttcctggcggctttagggcactctca
gattatattcactccaagggccttaagtttggaatgtacaacgatataggaaccaatctg
tgtgccggagcagaggttggaacctgcggacatgagaaagaggacgcagagaactacctt
gagtggggagttgatttcctcaaggtggataactgttattatctgtgggataatgcgacc
ttttcaaatcctgaaaatgcccgttacacatttgctcctaacataaggggtatcaggatc
ggggctgaagaattcccggtaatctatggagtccatgatggcggtgaggttagccttgca
gggatagagctcacaggggaaagggcttccagagaagaggactacattaccggaatcggg
acttttgatggtacaggtccggaagcttctcctgtcggacttcgcagcagcgagctggta
tttgttgtaaacgcagacagggatatggatactaccctttgcgttaactacgcatcaggc
aaaagagaaggtgtaggagcgtggcttcaggttgcggtaggagatgagtattactgggat
gatttccttgatgaaacaccatctgagggagactttatctggagcagggaaatatctata
aaacttaaaaaaggcgaaaacagaattcgtcttatgaatcaccgccgccaggagaatact
cttaattcctatgcaaggttgttaaaaaagctgaatagattagctcctgataatgacatt
atttattcagcctgtgaatggggtaagactcagcctcagaactgggcctacaaggtatgt
gattcctggagaatactaaatgatataacatttagagtgggccgtgacggagatccgggt
gttggtacctggacaggagattacacaacaagtgttgctacccagtacagcaaggctgtt
ataatggatgagtttgcaggacttgataaaggctggaatgacccggatatgatgatgatt
ggaatgaacggcctaaacgacgttcagaataaaacccacatgactatgtggtgtatgatg
aattcacctcttatgctcggacttgaccttagaagggtacacaagggggatacattgtat
aatattatcgccaatgaggatgccatttcccttaaccaggatagtcttggaattcaggcc
aagcgagttttttcaagtcttgctgccaaggagcctgataaagaatacataagagatatc
gacagagtggacattctctgcaagcctctttcaggaaacagatttgctctcagttttata
aatgtaagtgaaaaagatactgataaaacctatactataaaactctgtgatcttaaaaag
gctcttggagattggatatataagtgtgataaatatctggtcaaagatatatggactggc
gaaacaacagaaaatgagacaggagagttttctgtaaatggtcttgccgcctgcgataat
gttacatttattgtttcaccggcatctcctgtagaaatgaaataa

DBGET integrated database retrieval system