KEGG   Butyrivibrio proteoclasticus: bpr_I0227Help
Entry
bpr_I0227         CDS       T01292                                 

Gene name
recR
Definition
recombinational DNA repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:286210..286809
Genome map
AA seq 199 aa AA seqDB search
MELYSGHINKLIDELSSLPGIGGKSAQRLAFYLIGLPKDRVHKLADSIVNARENVHYCKE
CCTLTDDDICPICSNPGRDHKTIMVVENARDLAAYEKTGKFEGVYHVLHGAISPMLGVGP
GDIRLAELMQRLQTHEVEEVIVATNSSLEGETTAMYISKLIKPTGIKVTRIASGVPVGGD
LEYIDEVTLLRALEGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagctttacagcggacatatcaataagctgatagatgagttatcttctctcccggga
attgggggtaaatccgcgcagagactggctttttatctgatcggacttcccaaggacaga
gtgcataagcttgcagattcaattgttaatgcaagagaaaatgttcattattgcaaggag
tgctgtacccttactgatgatgatatctgtccaatatgtagtaatcccggcagagatcat
aagactattatggttgtagaaaatgcaagagatttagcagcatatgagaagactggtaaa
ttcgaaggcgtttatcatgtattgcatggggctatttccccgatgcttggcgtaggcccg
ggtgacattaggctggcagagctgatgcagagattacagactcatgaggtagaagaggtt
atagttgctaccaattccagccttgaaggtgagactactgcaatgtatatcagcaagctt
atcaaaccgacaggtattaaagtcaccaggattgccagtggagttccggttggaggagat
ctcgagtatatagatgaggtcactcttttaagagcgttggaaggtagaaccgagttataa

DBGET integrated database retrieval system