KEGG   Butyrivibrio proteoclasticus: bpr_I0279Help
Entry
bpr_I0279         CDS       T01292                                 

Gene name
bga2A
Definition
beta-galactosidase Bga2A (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpb00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bpb00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bpb00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:373938..377057
Genome map
AA seq 1039 aa AA seqDB search
MDKFEYSFIADPEVFKDNVLPAHGDFVSFATEDELAEGDTSLRISLNGLWKFHYAKNYRA
VVPGFEKEDYDCDFWDDIHVPAHMQMEGYDIPAYINVQYPWDGHEKIELGQVPEEFNPVG
SYVKYFNLPVQWNGQTVHVVFDGVESGYALWLNGHYVGYSEDTFTPSEFDLTPFLKEGVN
KLAVQVFKWTSSSWMEDQDFFRFSGIYRNVFLQLIPSAHLEDVKIRTLLNDEFTEAELEV
TYKTSGQGNLEYKLYRNNHPVVWGKVELPGDRTENVVKDKVTSPMLWSAEDPQLYQLVIK
VTDEDGNVLEVVSQNVGFRRFEMKDGLMLINGKRIVFKGVNRHEFSCDSGRVVSYEDTLK
DIITMKRNNINAIRTSHYQNSAAIYELCDIYGLYMIAENNLESHGSWSHLGNEAAIPYAI
PGSRENCMEMMLDRINSTYQLDKNHPSVLIWSIGNESHGGKVPYEMSQLFRKLDPDRLVH
YEGICHDRTYNDTSDMESQMYPPVVAIEKFLSEHPEKPFICCEYSHAMANSIGGMFKYTD
LAEREPRYQGGFIWDFIDQTIRAKNCFGEDYQAYGGDHGERPTDYSFSGNGIVNSDREPY
AKMQDVKFNYQNIRVTVERDKVKVVNNSLFTNTSEYDCLVILERDGKKLLEKHMATAVEP
LSEKEYELPEAITARMSVMGVEGYNENGPFPLDEYVVTVSFRLRDDSLWAERGHEVAFGQ
GVFRLAASTSICCAPLKVIKGDYNIGVKGNHFSVMFSRDKGNITSYNYGGKELIQGLGLP
RPNFWRAPVENDRGNNLAGRYAQWKIASSYASTAPIYEESTGYVNGSMEERWQYPKVIED
TNSVSVVCKFYLPTTPAASVLVTYTVTGDGRVWIKEEYEPVKGLTPMPEFGMLFRFSPEF
NKVEYYGNGPMENYVDRNRGAKLGIFNTTTTEAMEKYLLPEETGNRTGVRWAKVTDNRGR
GLLFEAPDTMNFSAIPYLPDELEAADHPYELPRVTKTIVRCSCMQMGIAGDDTWGAKTHP
EFLLPNDEKLTFVMSFRGI
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttgagtattcttttattgctgatccggaagtgtttaaagacaatgtgctc
cctgctcatggagattttgtgagctttgcgactgaggatgagcttgctgagggagataca
tcactgaggatttctttaaacggattgtggaaatttcattatgccaagaactacagagca
gtagttcctggatttgaaaaagaggattatgactgcgatttctgggatgatatacatgtt
cctgcccacatgcagatggaaggctatgacattccggcctatataaatgttcagtatccg
tgggatggacatgagaagatagagcttgggcaggttccggaggagtttaatcctgttgga
agttatgttaagtattttaatcttcctgtccagtggaatggacagacagttcatgtggta
tttgatggcgttgaaagcggctatgccctctggctcaatggccattatgtcggatatagc
gaagacacatttactccttcagagtttgatcttacccctttcttaaaagagggtgtaaat
aagctggctgttcaggtgtttaagtggacatcttcaagctggatggaggatcaggatttc
tttagattttcaggaatttatagaaatgtctttttgcagcttattccatcagcacatctt
gaggacgttaagatcagaactcttttaaatgatgagtttacagaggctgagcttgaggtt
acttataagacttcaggacagggcaatctggaatacaagctttatagaaacaatcaccct
gttgtatggggcaaagtggaactacctggtgatcgcacggaaaatgtggtaaaagacaag
gtgacatctcctatgttgtggagtgctgaggatcctcaactctatcagcttgttataaaa
gttacagacgaggatggaaatgttctcgaagtagttagccagaatgttggctttaggcgc
tttgaaatgaaagatggccttatgctgataaacggcaagcgaattgtgtttaagggtgtc
aacagacatgaattttcctgcgatagcggacgtgttgtttcttatgaagatacactcaaa
gacataatcacaatgaaaagaaataatataaatgccataagaaccagtcattatcagaat
tctgcggctatttatgaactttgcgatatttacggcttatatatgattgccgagaataac
ttggagtcacatggaagctggtcacatcttggaaatgaggcagcaattccctatgcaatt
ccgggcagcagagagaactgcatggagatgatgcttgataggatcaattccacatatcag
cttgataagaaccatccttcagtgcttatatggtctatcggaaatgagtctcacggaggc
aaagttccttatgagatgtctcagttgttcagaaaacttgatcctgacaggcttgtacac
tacgaaggaatctgtcatgacagaacttacaatgataccagtgacatggagagccagatg
tatcctcctgttgtggctattgagaagttcctctcagagcaccctgagaagccttttatc
tgctgcgagtattcacatgccatggctaacagcattggcggaatgttcaagtatactgat
cttgccgaaagagaaccccgctatcagggcggatttatctgggatttcatagatcagaca
attagggccaagaactgctttggcgaagattatcaggcctatggtggagaccatggagag
agaccgacagattatagctttagtggaaatggtatcgttaattctgatcgtgaaccttat
gccaagatgcaggatgttaagttcaactatcagaacatcagggtaactgtagaaagagac
aaggttaaagttgttaacaattctcttttcacaaatacaagtgagtacgattgcctggta
attcttgaaagagacggcaagaaacttcttgaaaagcacatggctacagctgtagagcct
ctttcagaaaaagagtatgagcttcctgaggctataacagcaagaatgtcagttatggga
gttgaaggctataacgaaaacggcccattcccgcttgatgagtatgttgtaaccgtttcc
ttcagacttcgcgatgattcattatgggcagagagaggacacgaggtagcctttggtcag
ggagtgttcagacttgcagcttctacatccatttgctgcgcaccgctcaaggtgataaag
ggtgactataatattggcgttaagggaaatcactttagcgtaatgttctcaagagataag
ggcaatattacatcatataattatggcggaaaagagctgatacaggggcttggacttcca
agaccaaacttctggcgtgctcctgtagaaaatgacaggggaaataatctggcaggaaga
tatgctcagtggaagattgcaagttcatacgcttcaacagcgcctatttatgaggaatct
acaggatatgtaaacggcagtatggaagagaggtggcagtatcctaaggttattgaggat
acgaacagtgtcagtgtagtgtgcaaattctatcttcctacaactcctgcagcatctgtt
cttgtaacttatacagttacaggggatggacgagtatggatcaaagaggaatacgagcct
gttaagggacttactccaatgcctgaatttggtatgctctttagatttagtcctgagttc
aataaggtcgagtattacggaaatggccctatggagaattatgtggacaggaacagagga
gctaagcttggaatattcaatactacaaccacagaagctatggagaagtatctgcttcct
gaggaaacaggaaacaggacaggagtaagatgggctaaggtaactgataacaggggaaga
ggcctgttgttcgaagcaccggataccatgaatttcagcgctattccatatttgccggat
gaactggaggcagcagatcatccttatgagcttccacgcgtaaccaagactattgtacgc
tgcagttgtatgcagatgggaatagcgggggatgacacatggggagccaagacacatcct
gaattcctgcttccaaacgatgaaaagcttacttttgttatgagctttagaggaatctga

DBGET integrated database retrieval system