KEGG   Butyrivibrio proteoclasticus: bpr_I0279Help
Entry
bpr_I0279         CDS       T01292                                 

Gene name
bga2A
Definition
(GenBank) beta-galactosidase Bga2A
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00052  Galactose metabolism
bpb00511  Other glycan degradation
bpb00600  Sphingolipid metabolism
bpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bpr_I0279 (bga2A)
  Lipid metabolism
   00600 Sphingolipid metabolism
    bpr_I0279 (bga2A)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    bpr_I0279 (bga2A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     bpr_I0279 (bga2A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ADL33027
UniProt: E0RYE6
Position
1:373938..377057
Genome map
AA seq 1039 aa AA seqDB search
MDKFEYSFIADPEVFKDNVLPAHGDFVSFATEDELAEGDTSLRISLNGLWKFHYAKNYRA
VVPGFEKEDYDCDFWDDIHVPAHMQMEGYDIPAYINVQYPWDGHEKIELGQVPEEFNPVG
SYVKYFNLPVQWNGQTVHVVFDGVESGYALWLNGHYVGYSEDTFTPSEFDLTPFLKEGVN
KLAVQVFKWTSSSWMEDQDFFRFSGIYRNVFLQLIPSAHLEDVKIRTLLNDEFTEAELEV
TYKTSGQGNLEYKLYRNNHPVVWGKVELPGDRTENVVKDKVTSPMLWSAEDPQLYQLVIK
VTDEDGNVLEVVSQNVGFRRFEMKDGLMLINGKRIVFKGVNRHEFSCDSGRVVSYEDTLK
DIITMKRNNINAIRTSHYQNSAAIYELCDIYGLYMIAENNLESHGSWSHLGNEAAIPYAI
PGSRENCMEMMLDRINSTYQLDKNHPSVLIWSIGNESHGGKVPYEMSQLFRKLDPDRLVH
YEGICHDRTYNDTSDMESQMYPPVVAIEKFLSEHPEKPFICCEYSHAMANSIGGMFKYTD
LAEREPRYQGGFIWDFIDQTIRAKNCFGEDYQAYGGDHGERPTDYSFSGNGIVNSDREPY
AKMQDVKFNYQNIRVTVERDKVKVVNNSLFTNTSEYDCLVILERDGKKLLEKHMATAVEP
LSEKEYELPEAITARMSVMGVEGYNENGPFPLDEYVVTVSFRLRDDSLWAERGHEVAFGQ
GVFRLAASTSICCAPLKVIKGDYNIGVKGNHFSVMFSRDKGNITSYNYGGKELIQGLGLP
RPNFWRAPVENDRGNNLAGRYAQWKIASSYASTAPIYEESTGYVNGSMEERWQYPKVIED
TNSVSVVCKFYLPTTPAASVLVTYTVTGDGRVWIKEEYEPVKGLTPMPEFGMLFRFSPEF
NKVEYYGNGPMENYVDRNRGAKLGIFNTTTTEAMEKYLLPEETGNRTGVRWAKVTDNRGR
GLLFEAPDTMNFSAIPYLPDELEAADHPYELPRVTKTIVRCSCMQMGIAGDDTWGAKTHP
EFLLPNDEKLTFVMSFRGI
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttgagtattcttttattgctgatccggaagtgtttaaagacaatgtgctc
cctgctcatggagattttgtgagctttgcgactgaggatgagcttgctgagggagataca
tcactgaggatttctttaaacggattgtggaaatttcattatgccaagaactacagagca
gtagttcctggatttgaaaaagaggattatgactgcgatttctgggatgatatacatgtt
cctgcccacatgcagatggaaggctatgacattccggcctatataaatgttcagtatccg
tgggatggacatgagaagatagagcttgggcaggttccggaggagtttaatcctgttgga
agttatgttaagtattttaatcttcctgtccagtggaatggacagacagttcatgtggta
tttgatggcgttgaaagcggctatgccctctggctcaatggccattatgtcggatatagc
gaagacacatttactccttcagagtttgatcttacccctttcttaaaagagggtgtaaat
aagctggctgttcaggtgtttaagtggacatcttcaagctggatggaggatcaggatttc
tttagattttcaggaatttatagaaatgtctttttgcagcttattccatcagcacatctt
gaggacgttaagatcagaactcttttaaatgatgagtttacagaggctgagcttgaggtt
acttataagacttcaggacagggcaatctggaatacaagctttatagaaacaatcaccct
gttgtatggggcaaagtggaactacctggtgatcgcacggaaaatgtggtaaaagacaag
gtgacatctcctatgttgtggagtgctgaggatcctcaactctatcagcttgttataaaa
gttacagacgaggatggaaatgttctcgaagtagttagccagaatgttggctttaggcgc
tttgaaatgaaagatggccttatgctgataaacggcaagcgaattgtgtttaagggtgtc
aacagacatgaattttcctgcgatagcggacgtgttgtttcttatgaagatacactcaaa
gacataatcacaatgaaaagaaataatataaatgccataagaaccagtcattatcagaat
tctgcggctatttatgaactttgcgatatttacggcttatatatgattgccgagaataac
ttggagtcacatggaagctggtcacatcttggaaatgaggcagcaattccctatgcaatt
ccgggcagcagagagaactgcatggagatgatgcttgataggatcaattccacatatcag
cttgataagaaccatccttcagtgcttatatggtctatcggaaatgagtctcacggaggc
aaagttccttatgagatgtctcagttgttcagaaaacttgatcctgacaggcttgtacac
tacgaaggaatctgtcatgacagaacttacaatgataccagtgacatggagagccagatg
tatcctcctgttgtggctattgagaagttcctctcagagcaccctgagaagccttttatc
tgctgcgagtattcacatgccatggctaacagcattggcggaatgttcaagtatactgat
cttgccgaaagagaaccccgctatcagggcggatttatctgggatttcatagatcagaca
attagggccaagaactgctttggcgaagattatcaggcctatggtggagaccatggagag
agaccgacagattatagctttagtggaaatggtatcgttaattctgatcgtgaaccttat
gccaagatgcaggatgttaagttcaactatcagaacatcagggtaactgtagaaagagac
aaggttaaagttgttaacaattctcttttcacaaatacaagtgagtacgattgcctggta
attcttgaaagagacggcaagaaacttcttgaaaagcacatggctacagctgtagagcct
ctttcagaaaaagagtatgagcttcctgaggctataacagcaagaatgtcagttatggga
gttgaaggctataacgaaaacggcccattcccgcttgatgagtatgttgtaaccgtttcc
ttcagacttcgcgatgattcattatgggcagagagaggacacgaggtagcctttggtcag
ggagtgttcagacttgcagcttctacatccatttgctgcgcaccgctcaaggtgataaag
ggtgactataatattggcgttaagggaaatcactttagcgtaatgttctcaagagataag
ggcaatattacatcatataattatggcggaaaagagctgatacaggggcttggacttcca
agaccaaacttctggcgtgctcctgtagaaaatgacaggggaaataatctggcaggaaga
tatgctcagtggaagattgcaagttcatacgcttcaacagcgcctatttatgaggaatct
acaggatatgtaaacggcagtatggaagagaggtggcagtatcctaaggttattgaggat
acgaacagtgtcagtgtagtgtgcaaattctatcttcctacaactcctgcagcatctgtt
cttgtaacttatacagttacaggggatggacgagtatggatcaaagaggaatacgagcct
gttaagggacttactccaatgcctgaatttggtatgctctttagatttagtcctgagttc
aataaggtcgagtattacggaaatggccctatggagaattatgtggacaggaacagagga
gctaagcttggaatattcaatactacaaccacagaagctatggagaagtatctgcttcct
gaggaaacaggaaacaggacaggagtaagatgggctaaggtaactgataacaggggaaga
ggcctgttgttcgaagcaccggataccatgaatttcagcgctattccatatttgccggat
gaactggaggcagcagatcatccttatgagcttccacgcgtaaccaagactattgtacgc
tgcagttgtatgcagatgggaatagcgggggatgacacatggggagccaagacacatcct
gaattcctgcttccaaacgatgaaaagcttacttttgttatgagctttagaggaatctga

DBGET integrated database retrieval system