KEGG   Butyrivibrio proteoclasticus: bpr_I0304Help
Entry
bpr_I0304         CDS       T01292                                 

Gene name
xyn10A
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bpb  Butyrivibrio proteoclasticus
Brite
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     bpr_I0304 (xyn10A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:407432..408862
Genome map
AA seq 476 aa AA seqDB search
MYKQGRSLVAVMAASVMLTLTACGGTTDHQSAAVSEAESISATSDNSLNSTSTEESNKDV
TDASSESSSSEQEGDEDNVPALRDCVEQKMGCRIGCAITGKEPWDIPLWNLVTTHFNAVT
LGNELKPDSLFGYSNGKCPGTQEAELNGETIMVPVLNFDNPEKILNKFVKWNEVHPDREI
KVRGHVLVWHSQTPEWFFHQDYDKTKPYVSKEEMDKRQEWYIREVLTHFTGEDSPYKDLF
YGWDVVNEAVSDATGTYRTDNENPNEDLSNDTHGNNSSWWHVYQSEEFIINAFKYANKYA
PADLELYYNDYNECMAKKREGIVALLKEVKEQEGEPGTGTRITAMGMQGHYGVDSPSYTE
VETSAKAYGDVVGNIQITEWDLSSSDDYDGSPEAKEKEYEKMRKTYNLQYYALQSVQNSG
VNVTGITFWGTVDKYSWLQHRSTVGGGSNKEKAQCPLLFDDLYKPKPAFWVFAETN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgtataaacagggcagatctttagttgctgtcatggcagcttcagtgatgctgacgctt
acagcctgtggggggaccacggatcatcaatcagcggcggtatcggaagcggagagcatt
tcagcaacgtcagataattcacttaacagtacttccacagaagaatcgaataaagatgta
acggatgcatcatcagaatccagttcgagcgagcaggagggcgatgaggacaacgtgccg
gcgctgagagattgcgttgaacaaaagatgggatgtcggatcggttgtgcgatcacaggc
aaggaaccatgggacattccattatggaatctggtcacaacacattttaatgcagttact
cttggaaacgaactcaaaccggattcacttttcggatacagcaatggaaaatgtccggga
acacaggaagctgagcttaacggagaaacaataatggttccggtcctgaattttgataat
ccggaaaagatacttaataaattcgttaagtggaatgaggtacatccggacagggagata
aaagtcagaggccatgtacttgtatggcattcacagacacctgaatggttttttcatcag
gattacgacaagaccaaaccatatgtttccaaagaggaaatggataagagacaggagtgg
tatataagagaagtccttactcatttcaccggagaggatagtccatataaagatcttttt
tatggatgggatgttgtcaatgaagcagtttcagatgcaacgggaacttacagaactgac
aatgagaatccaaacgaagacctctcaaatgatacacatggtaataactccagctggtgg
cacgtttaccaaagcgaagagttcattataaatgcatttaaatacgccaacaaatatgct
ccggcagatcttgagctgtactacaacgactacaacgagtgtatggccaagaagagagag
ggaattgtagctcttttgaaagaggtcaaggagcaggagggcgagcctggaacaggaacc
agaataacagcgatgggaatgcagggacattacggagttgattctccttcctacacagag
gtcgagacatctgccaaggcctacggcgatgtagtaggaaacattcagatcacagaatgg
gatctgagctccagtgacgactacgatggcagtcctgaagctaaggaaaaagaatatgag
aagatgcgtaagacatacaaccttcagtattatgcacttcaatcagttcaaaactccggt
gtgaatgtgacaggtattaccttctggggaacagttgacaagtattcatggctgcagcac
agatctacagtaggcggtggcagtaacaaagaaaaagcacagtgcccacttctgttcgat
gatctgtacaagccaaaacctgcattttgggtttttgcagaaactaactaa

DBGET integrated database retrieval system