KEGG   Butyrivibrio proteoclasticus: bpr_I0471Help
Entry
bpr_I0471         CDS       T01292                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00240  Pyrimidine metabolism
bpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    bpr_I0471 (tdk)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     bpr_I0471 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 DUF2075 PhoH Bac_DnaA
Motif
Other DBs
NCBI-ProteinID: ADL33219
UniProt: E0S018
Position
1:606529..607152
Genome map
AA seq 207 aa AA seqDB search
MGESMGKLYFRYGAMGSSKTANALMVRYNYYEKGQNAIILKPQTENRDGEKTVKSRMGLS
AECTFVEEFLETVQNEWLTGKSDSWKELDCVIVDEAQFLTEEQVDMLALVVDKYDLPVIC
YGLRTDFTSHLFTGSKRLMEIANYIEEVPTVCWCGRRAHFNARVHNGKIVRSGEQIMMGG
NESYVSVCRRHFISGEVSGPRERDVEE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgggggaaagtatgggaaagttatatttcaggtatggagcaatgggaagctccaagaca
gcaaatgcgctgatggtgcgctacaattactatgagaaggggcagaacgctattattctg
aaacctcagacagagaacagggatggggaaaaaactgtcaaatcccgcatgggacttagt
gcagagtgcacatttgttgaggagtttttagagactgttcagaatgaatggctcacgggg
aaatctgattcatggaaggaactggactgcgtaattgttgatgaagcgcagtttttgaca
gaagagcaggttgatatgctggctcttgttgtggataagtatgaccttccggttatctgt
tatggacttcgtactgattttacgagtcatcttttcacaggttccaagcgacttatggag
attgccaattatatagaggaagtccctactgtctgctggtgcggcagaagggctcatttt
aatgcccgtgttcataatggcaagatcgtcagaagcggtgagcagatcatgatgggtggc
aatgagtcttatgtttccgtatgtaggagacattttatatcaggagaagtaagcggcccg
agagagagggacgttgaggagtga

DBGET integrated database retrieval system