KEGG   Butyrivibrio proteoclasticus: bpr_I0563Help
Entry
bpr_I0563         CDS       T01292                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:717902..719191
Genome map
AA seq 429 aa AA seqDB search
MEKYVIKGGNPLVGEVEIGGAKNAALAILAAATMTDETVYIDNMPDESDTNAMLQAIAST
GAHVDRVDRHSVKINASAVRNFTIEDYIKKIRASYYLLGAFLGKYKQAGVVLPSGCNIGL
RPIDQHIKGFTALGATVNIEHGIIDAHADALVGSHIYLDVVSVGATINIMMAATMAEGKT
IIENAAKEPHVVDFANFLNSMGANIKGAGTDVIRIKGVERLHGTEYTIIPDQIEAGTFML
AAAATKGDITVKNVIPKHLESISAKLIEMGCQVHESDDAVRVVATRRLQNTHVKTLPYPG
YPTDMQPQITVALGLASGISIVTESIFENRFKYVDELTRMGACIKVEGSTAIIEGVDKYT
GAVVSAPDLRAGAALVIAALTAEGYSTVEDIKYIERGYEDFDQKIRDLGGIIEKVDSDRD
EQKFKMKHA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatgtaataaagggcggcaatccacttgtaggtgaagtggagattggtggc
gccaaaaatgctgctttggctattctggcagcagctaccatgactgatgagaccgtctat
atagataatatgcctgatgagtcagatactaacgcgatgcttcaggctatagcgagtacc
ggagcacatgtagacagagtagacagacattctgtcaagatcaatgcttctgcagtacgc
aattttacaatcgaagattacatcaagaagattcgagcatcttattatcttcttggagca
tttcttggtaaatacaagcaggcaggagttgttcttccaagcggatgtaatatcggactt
cgtcctattgaccagcatattaagggattcacagctcttggagctacagttaatattgag
catggcattattgatgcacatgctgatgcacttgttggaagtcatatttatcttgatgta
gtgagtgttggagctactatcaacattatgatggcggctactatggcagaaggtaagact
attatcgagaatgcagccaaggagcctcatgtagttgattttgcaaacttcctcaacagt
atgggtgccaatattaagggcgcaggtactgatgttatcaggatcaagggcgttgagaga
cttcatggaacggaatatactattattcccgatcagattgaggcaggaacctttatgctt
gcagcggctgctaccaagggagatataactgtcaagaatgttatccccaagcatctggaa
tcaatcagcgccaagcttattgagatgggatgtcaggttcacgagtcagatgatgcagtt
agagtagtggcgaccagacgacttcagaatactcatgtcaagacacttccatatcctgga
tatccgacagatatgcagccacagattacagttgcacttggacttgcaagtggtatcagt
attgtaacagagagtatttttgagaatagattcaaatacgtagatgagcttaccagaatg
ggagcttgtatcaaggttgaaggtagcactgctattattgagggtgtggacaaatataca
ggagctgtagtttcagcacctgaccttagagcaggagctgcacttgtaattgcggcgctt
actgcagaaggttattctactgttgaagatatcaaatacattgagagaggctatgaagat
tttgatcagaagattagagatcttggtggtattatcgagaaggttgattctgacagagac
gaacagaaatttaaaatgaaacatgcataa

DBGET integrated database retrieval system