KEGG   Butyrivibrio proteoclasticus: bpr_I0712Help
Entry
bpr_I0712         CDS       T01292                                 

Gene name
asnB6
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bpr_I0712 (asnB6)
Enzymes [BR:bpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     bpr_I0712 (asnB6)
Peptidases [BR:bpb01002]
 Cysteine Peptidases
  Family C44
   bpr_I0712 (asnB6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:858723..860585
Genome map
AA seq 620 aa AA seqDB search
MCGINGIFQFRRKFEIDKLSNYIGIMNQSIVHRGPDGEGVYVDETCALGMRRLSIIDLEK
GDQPIWNDDRTKAIIFNGEIYNYQELRNNLLGKGIGFSTNSDTEVILKGIESEGISFINR
LEGMFAFAIYDKKQQTVLLARDRLGEKPLYYAEDDGVLYFASELKSILSIGVIKKQINTI
AFSQYLHLSYIPSPLTIIEGVYKLRPGYWMNMNSFGKTETIQYWDEHIDPKTIITDYDLG
KELLRKSVEESVKKCMVADVPVGVFLSGGIDSGIVAGLMAQYSAKPISTFTLGFSEKEYD
ESKRAEIIVQKYKTDHHIKVVKSEDVFEALPTVIESMGEPFADQSIIVTYILSAFTRKYV
KAVLTGDGGDELFAGYNRYLIEYYSQKYNEMPDPVKKMSDLVLRNIDGRTRLSRKVSKVI
DNANLPLDVQRLNLMCLAFNKSTILGKDSEEIYRDIRNCYEKYIGVTDEINRILYTDLKV
SLEGDMLAKVDRASMLASLETRVPLLGKNVVETSFMMPGTFKIAGRQQKKIFKEAFEDII
PNELRKKSKRGFDVPISKWIRNDLRTDMEKTISGGYAISEGMISKSAVNEMITRHISGYK
NYSMELWSLYVFEKWYVRNI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaataaacggaatatttcaattcagaagaaaatttgaaatagataaactatcg
aactatataggaataatgaatcagagcatagttcacagaggaccagacggtgagggtgta
tatgttgatgaaacatgtgctctggggatgagaaggctttccataattgatctggaaaag
ggcgatcagcctatttggaatgacgatagaacaaaagcgattatttttaatggagaaata
tataactaccaagaattaagaaacaatctattgggaaaaggtattggtttcagtactaat
agtgatacagaagtaatattaaagggaattgagagtgaaggaattagttttatcaacaga
ctagaagggatgtttgcttttgctatatatgataaaaagcaacagactgttttgctggcg
agagaccgattgggagaaaagcccttatattatgctgaagatgatggggtattatatttt
gcatcagaactgaaaagtatactttcgataggtgtaataaaaaaacagataaatacgata
gctttttcgcagtatctgcatctttcatatataccatccccactaacaattattgagggt
gtgtataaattacgcccaggatattggatgaatatgaattcatttgggaaaacagaaacc
attcaatattgggatgagcacatagatcctaaaacaataattactgattacgaccttgga
aaagaactgctcagaaaatcggtagaggaatctgtaaaaaaatgcatggttgcagatgtc
cctgtaggtgtttttctttctggagggatagattctggaatagttgcaggattaatggca
cagtatagcgcgaaacctattagtacttttacattaggttttagcgaaaaggaatatgat
gaaagtaaacgagcagaaataatagttcagaaatataaaactgatcatcatataaaagtt
gttaaaagtgaagatgtatttgaggctttaccaacagtcatagaaagcatgggtgaaccc
tttgctgatcaatcaataatagtgacatatattttgtctgcctttactaggaaatatgtc
aaagcagttttgactggtgatggaggagatgaactatttgctggctataacagatatctt
attgagtattattcccaaaaatataacgagatgccagatccagtaaagaagatgtctgat
ttagttcttcgaaacatagatggaaggacaagattgtcaagaaaagtgtcgaaagtcata
gacaatgctaatcttcctttggatgtacaaagattaaatctgatgtgtttggcttttaac
aaatctacgatactaggtaaggatagcgaagaaatatatagagatatcaggaattgctat
gaaaagtatattggcgtgacagatgaaataaatcgcattctgtatacagacttaaaagtg
tctttggaaggtgatatgctggcgaaagtagacagggcttcgatgttggcttcgctggaa
acaagagtgcctttgttggggaagaatgttgttgaaacctcattcatgatgcctggaaca
tttaaaatcgctggtagacagcagaaaaaaatctttaaagaagcctttgaagatattatt
cctaatgagcttagaaagaaatctaaacgaggctttgatgttcctataagtaaatggata
agaaatgacttaagaacggatatggaaaaaaccataagtggtggatatgcgataagtgaa
gggatgatcagcaagtctgctgtaaacgaaatgataactcggcatatcagtggttataag
aactatagcatggagttgtggagcttgtatgtttttgagaagtggtatgtgagaaatata
tga

DBGET integrated database retrieval system