KEGG   Butyrivibrio proteoclasticus: bpr_I0788Help
Entry
bpr_I0788         CDS       T01292                                 

Gene name
aga36A
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bpr_I0788 (aga36A)
  Lipid metabolism
   00561 Glycerolipid metabolism
    bpr_I0788 (aga36A)
   00600 Sphingolipid metabolism
    bpr_I0788 (aga36A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     bpr_I0788 (aga36A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:969552..972035
Genome map
AA seq 827 aa AA seqDB search
MGIDITDIVLEGNELIYADGNIFLLQTAHTSYLFRRTASGHLEHIHYGKSIISEDKYQKA
VEAGDLEQAFKDGKNGLMSIADAIGPKHYHGGGNMNVYSDDHKDTFLEMLGLEMSSFGKG
DIREPFVELTYADGNTTVDFQYYSMKVTDGKKALRTLPSSYDDTDVSGDNSAVKKDKTQQ
LIIVLKDPGYGTSLEMIYSVFPDSDVITRSAVLHNDSDKEVRIERLLSTQIDFDTRALKF
TSFHGRWADEMGIHTSLCTGGKVVCEELAAGESGSRSNPLVIVSEPDADEEHGGCIGFNL
VYSGNHYEALSSNAKNMSRFVCGIQPVGFNWLLAPGEAFEAPEAVMAYSDKGFNGMSLRM
QDFVRRHIVRGSWRDKERPILINSWEASYFNITQNSLLSLAKEAKKCGIELFVMDDGWFG
KRNDDTSSLGDWYENKKKLPGGIKELADRINELGLMFGIWVEPEMVNEDSDLYRAHPDWA
VAVPGKPHSKGRNQMNLDLSRTEVQDYVIDAMKKVFSAGNVSYVKWDMNRIFSDRFSTSL
PADRQGEFQHRYYIGLYRIMKELTESFPEILFEGCSAGGNRFDLGILCYFPQIWGSDDTD
AFCRLDIQRGYSYGYPANTIGAHVSACPNHQTLNTVPLETRFEIACPGCFGYELNLCEMS
ESDKKIVTSQVEFYKKWREVFQFGDYYRLPDYGYMIVTRDQKKAVGFVVEKGSRPNNDYR
KLKCVGLDDDKLYNIVNRVVPLNLKDFGSLVNAIAPVHVKQDGIIHNIMDKVVHMNGEEQ
KAVATGAALNSHGFALNANFAGTGYNQDTRIMRTGDSRLYTFEEVAE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgggaatagatataacagatatagttttggagggtaacgaattgatttacgcagatgga
aacatctttttgctgcagacagcacatacatcttacttgttcaggaggactgcgtcaggg
catcttgaacacattcactatggaaaatccattatttctgaggataaatatcagaaagct
gtagaggcaggcgaccttgaacaggcctttaaggatggcaagaatggtcttatgagtatt
gctgatgcaattggacctaagcattaccatggcggcggaaatatgaatgtgtattccgat
gaccataaggatacttttctggagatgctgggcctagaaatgtcatcttttggcaaggga
gatattagagagccgtttgtggagctgacttatgctgatggcaatactacagtggatttc
cagtattacagcatgaaggtcacagatggcaagaaggcgcttaggacacttccgtcatcc
tatgatgacacggatgtttccggtgacaatagtgctgtcaaaaaggataaaactcagcag
cttattatcgttctcaaggatccaggatatgggactagccttgaaatgatctattctgta
tttcctgacagtgatgtcattacaagaagtgcagtgcttcataatgacagcgataaggag
gttaggatcgagaggcttcttagtactcagattgactttgatactcgtgcacttaaattc
acttctttccacggcaggtgggctgatgaaatgggaattcatacaagtctgtgcaccggt
ggcaaggttgtgtgtgaagaacttgcggcaggcgagtcaggatcaaggtctaacccgctt
gttatcgtgagtgaaccagatgcagatgaggagcacggcggatgtataggctttaatctt
gtatacagtggcaatcactatgaagctctttcttctaatgccaagaatatgagcagattc
gtatgtggtattcagccggtaggctttaactggcttcttgcaccgggagaggcctttgag
gctcctgaagctgttatggcttattctgacaagggctttaacggcatgagtcttagaatg
caggattttgtaagacgccatattgtaagaggctcctggagagacaaggagagacctatc
cttatcaacagctgggaagcgtcatactttaacattacacagaattctcttttatccctt
gcaaaagaggcaaagaagtgcggtattgagctctttgtaatggatgatggctggtttggc
aagcgtaatgatgatacttcatcacttggcgactggtatgaaaataagaaaaagcttccg
ggtgggatcaaggagcttgctgatagaataaatgagcttggtctcatgtttggtatatgg
gttgagcctgagatggtcaatgaggatagtgatctgtacagggcgcaccctgactgggct
gtagctgttccgggaaaaccacattccaaaggccgtaatcagatgaaccttgatctgtcc
aggacagaagttcaggactatgtcattgacgccatgaagaaggtcttttccgcaggcaat
gtgtcctatgtcaaatgggatatgaacagaatcttctcagacagattctctacaagtctt
cctgctgacagacagggcgagtttcagcatagatattatattggcctgtaccgtattatg
aaggagctgacagagagctttcctgagatattgtttgagggatgctctgcaggcggcaac
agatttgaccttggcattctgtgctatttcccacagatatggggaagcgatgatactgat
gctttctgcagacttgatattcagagaggctatagctatggatatcctgcaaacacaatt
ggcgcgcatgtttcagcatgccctaaccatcagactcttaacacagtgcctcttgagaca
agatttgagatagcttgtccgggatgctttggttatgagcttaatctgtgcgaaatgtca
gaatcagataagaagattgttacctctcaggttgagttctacaagaagtggagagaagta
ttccagtttggcgactattacagacttccagactatggatatatgatcgttacgagggac
cagaagaaggctgtaggctttgttgttgaaaagggcagcagacctaataatgactatcga
aagcttaagtgtgtcggccttgatgacgataagctttataatatcgtaaaccgcgtggtt
ccgcttaatctcaaggattttggaagccttgtcaatgctatagcacctgttcatgttaaa
caggatggaatcatccacaatattatggataaggttgttcacatgaacggcgaggaacag
aaagcagtagcaacaggagctgcgctcaacagccatggctttgctcttaatgcaaacttt
gcaggaaccggatataatcaggatactcgtatcatgagaaccggtgattcaaggttatat
acatttgaagaagtcgctgaataa

DBGET integrated database retrieval system