KEGG   Butyrivibrio proteoclasticus: bpr_I0912Help
Entry
bpr_I0912         CDS       T01292                                 

Gene name
bhx3A
Definition
beta-N-acetylhexosaminidase Bhx3A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_I0912 (bhx3A)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    bpr_I0912 (bhx3A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bpr_I0912 (bhx3A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1117405..1119165
Genome map
AA seq 586 aa AA seqDB search
MSIKIDYKANPFCLDDEAIKWVEDTFASMTEDEKCGQVFCPMGFSNDDNVLRGIVEGAAV
GGMMYRSGPAKELRATHRKIQDMARIPLLIAANTEAGGDGLSFEGTSFGKPMAVAATNDP
ENGYRMGYVACKEGAALGLNWSFAPIVDINREFHNPITNVRTFGDDPKKIEAFASRYMDG
ADECGVAVSIKHFPGDGIDERDQHIVTSVNSLGVREWDESFGYIYGSLIGKGAKTVMVGH
IAQPAYVKEINRDATKEEMLRPASLSKELLQGLLRGKLGFNGLIITDATPMVGFTSAMPR
SRAIPTAIMSGCDMILFNKDLSEDIGFLKDGLKSGLLTNERLDEAVLRILATKASLGLHV
KQREGRLVPPEDAIDIVGCSEHRAFAKEVADKAITLVRDEKALLPVNPGKYKRIYLNVID
KEMDPCSDFALMWKEKLEKEGFEVTVRDRRTRITPMDFMDVENLPDKKKALLNEMYRSVS
EMKKDYDLYIYVCNMENASNNTTLRLNWNVLFGLGDDAPWHAKEIPMIMVSTAYPYHLFD
APMIGTYINAYSGNEDFCNAVIEKLMGRSKFEGVSPIDPFCGKDYI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaagattgattataaagcaaacccgttctgccttgatgatgaggcgataaag
tgggtagaggatacctttgcctcaatgacggaagatgagaagtgtgggcaggtattctgc
cccatgggattttccaatgacgataatgttcttcggggcatagttgaaggcgcagctgtg
ggaggaatgatgtacagaagcggcccggcaaaagaactgagagccacccacaggaagata
caggacatggccaggattcctcttcttatcgctgccaatacagaggccggaggagacgga
ctctcctttgaggggacgagttttggaaaaccaatggcggtagctgcaacaaacgatccg
gaaaacggataccggatgggatatgttgcctgcaaagaaggcgcagcgcttgggcttaac
tggtcctttgcccctatcgtggatatcaacagggaatttcacaatcccataaccaatgta
aggaccttcggagatgacccgaagaaaatcgaagcctttgcctcaagatacatggatgga
gccgatgaatgcggcgtagcggtatcaatcaagcactttcccggagacggcatagatgag
agggaccagcacatcgttacaagtgttaactcacttggcgtcagggagtgggatgagagc
tttggctatatctacggatcgcttataggcaagggagcaaagaccgtgatggttggacat
atcgctcagcctgcctatgtaaaggagattaacagggatgccacaaaagaggagatgctc
cgccccgcctctctttctaaggagctcctgcagggactgcttagaggaaaacttggcttt
aacggtcttatcatcactgatgcgaccccgatggtgggctttacctcggcaatgccaagg
agcagggccatccctacggcaattatgagcggctgcgatatgatcctctttaacaaggat
ctttccgaggacatcggctttttgaaagatggactgaaaagcggtcttcttacaaatgag
cgcctggatgaggcggttcttcgcatccttgccacaaaggcctcactggggcttcatgta
aagcagagggaaggaagacttgttcccccggaggatgccatagacattgttggctgcagt
gagcatagagcttttgcaaaagaggttgccgataaggccatcacacttgtcagggatgag
aaggctcttttgcctgtaaatccgggtaaatataagaggatataccttaatgttatagac
aaagagatggatccctgcagcgattttgcgctgatgtggaaggaaaagcttgagaaggaa
gggttcgaagttaccgtaagggacaggagaacgcggataacgcccatggatttcatggat
gttgaaaacctcccggacaagaagaaggctcttttgaatgaaatgtacagaagcgtttcc
gagatgaagaaggattacgatctgtatatctatgtctgcaacatggagaatgcatccaat
aacaccaccctgcgtcttaactggaatgtgctctttggcctcggtgatgatgctccctgg
catgcaaaagagataccgatgataatggtctccactgcatacccctatcatctttttgat
gcacccatgatcggaacctatatcaatgcttacagcggtaatgaagacttctgcaatgct
gtgattgaaaaactcatgggaagatcgaagtttgagggagtaagccccatagatcccttc
tgcggaaaggattacatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system