KEGG   Butyrivibrio proteoclasticus: bpr_I0938Help
Entry
bpr_I0938         CDS       T01292                                 

Gene name
bga35A
Definition
beta-galactosidase Bga35A (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bpr_I0938 (bga35A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     bpr_I0938 (bga35A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1154420..1156288
Genome map
AA seq 622 aa AA seqDB search
MGKFEIKDTFYLNGEPFKVISGSFHYFRTVPEYWVDRLEKLKALGCNTVETYIPWNLTEP
KKGEFNFEGFCDVEKFIQTATELGLYIIIRPSPYICAEWEFGGLPAWLLKDRNMRLRVSY
KPFLDAVEDYYKVLMPKITKYQIDNGGNVILMQIENEYGYYANDHEYMKFMHDLMVKYGV
TVPLITSDGPYHESYRGGYAEGAHPTGNFGSKTEERFDVIKDYTNGGPLMCAEFWVGWFD
HWGNGGHMKGNLVQSAEDLDKMLELGNVSIYMFQGGTNFGFMNGSNYYDALTPDVTSYDY
DGILTEDGQITEKYRKYQEIIGKYVDVPEVELTTKIQRKSYGTLTCTDKVSLFETLDTIS
TPVHLPYTVNMEELDQNYGYILYRSRLHSEAGIAKLKLWETGDRANVFVEENPLITLYDL
ELNDEHNIPMEKYLACSQPAQMLAGKFMMERGLTPETAAAAIGEAGLSTGTLQGLNEKFD
ILVENMGRVNFGPRMETQRKGIGRCVQINGHIHNDWDIYTLPLDNVDKVDFSGDYKEGAP
AFYKFTFNVDEKGDTFLDFTGWGKGVAFINGFNLGRFWEIGPQKRLYIPAPLLKDGENEI
IIFETEGKVRDTIELKDEPDIG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatttgaaattaaggataccttttaccttaacggtgaaccatttaaggttata
tccggttcttttcactattttaggactgttccggaatactgggttgacagactggaaaag
ctaaaggcccttggttgtaatacagttgaaacttatattccctggaatcttacagaacct
aaaaagggagagtttaattttgaaggtttctgtgatgttgagaagtttatacagactgct
acggagcttggactttatattattatcagaccatctccatatatctgcgcagagtgggaa
tttggcggacttccggcatggctgttaaaagatagaaacatgcgccttagagtgagctat
aagccgttcctggatgcagttgaggattactataaggttcttatgcccaagatcaccaaa
tatcagattgataatggcggaaatgtcatcctcatgcagattgaaaatgaatatggatat
tatgctaatgaccatgagtatatgaagtttatgcatgatcttatggttaaatatggcgtt
actgtacctcttattacatcagacggaccttatcacgagagctatagaggcggttatgca
gagggagcacaccctacaggaaactttggttccaagacagaggaacgatttgatgtgatc
aaagattacacaaatggcggacctctcatgtgtgctgagttctgggttggatggtttgat
cactggggaaatggcggtcacatgaagggaaaccttgttcagagcgcagaggaccttgat
aagatgcttgaacttggtaatgtcagcatctatatgttccagggcggaacaaactttggg
ttcatgaatggatcaaactattatgatgcgcttactcctgatgtcacaagctatgactat
gatggaatactcacagaggatggacagataacagagaagtatcgtaaatatcaggaaatc
attggtaagtatgtagatgttcctgaggttgaacttactactaagattcagagaaagagc
tatggaacactgacatgtactgataaggtatctctttttgaaacacttgataccatcagc
actcctgtacatcttccatatacagttaacatggaagaacttgatcagaactatggatat
attctctacagatcaaggcttcattcagaggcgggaattgccaagctcaaactttgggag
actggtgacagggcaaatgtatttgttgaggaaaatcctcttattaccctgtatgatctg
gaacttaacgatgagcataacattcctatggaaaaatatcttgcatgttctcagcctgca
cagatgctcgcaggaaagttcatgatggagagaggacttactcctgaaacagctgctgca
gctatcggagaagcaggcctgtctacaggaactctgcagggacttaatgagaaatttgat
attcttgttgagaatatgggacgtgttaatttcggacctcgtatggagacacagagaaag
ggtattggcagatgtgtccagataaacggtcacattcacaatgactgggatatttataca
cttccacttgataacgtagataaggttgatttctcaggagattataaggaaggagcacct
gctttctacaagtttacatttaatgttgatgaaaagggcgatacattccttgattttact
ggctggggcaagggcgtcgcatttataaatggcttcaacctcggcagattctgggagatt
ggaccacagaagagactgtatattcctgctcctcttttaaaagatggcgagaatgagatc
attatatttgaaactgaaggaaaagtcagagatactatcgagcttaaggatgagccagat
atcggatga

DBGET integrated database retrieval system