KEGG   Butyrivibrio proteoclasticus: bpr_I0957Help
Entry
bpr_I0957         CDS       T01292                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase Dxr (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpr_I0957 (dxr)
Enzymes [BR:bpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     bpr_I0957 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1174750..1175892
Genome map
AA seq 380 aa AA seqDB search
MHRNIVLLGSTGSIGTQTLDVVRNNPDELTVVGLAANRRVAEVEAQVREFKPKYVCMYDE
AAAKDLQTRIADLGIKVMSGMEGLLEIVSVPEADTVLTAVVGMIGIQPTIRAIESGKDIA
LANKETLVCAGHIIMPLAAQKKVQILPVDSEHSAIFQSLNGEPRDKVEKILLTASGGPFR
GKKREELATMTAADALKHPNWDMGPKVTIDSSSLVNKGLEVMEARWLFDVSLDNIQVVVH
PQSIVHSAVQYVDGAVIAQLGVPDMKLPIQYALFYPDRRPMAEKRLDLFELHSLTFEKPD
TDTFRGLKLAFDAAYAGGSMPTVFNAANEMAVKAFLKGDIKYLEIYDMIERAMNHHVRID
NPDVAAILAAEKETYDYLGR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcatagaaatatagtactactgggttcaacaggatcgattggaacccagactttggat
gtagtaaggaataatccggatgagcttacagttgtgggacttgcggctaacaggcgagtt
gcagaagttgaggctcaggtaagagagtttaagcctaaatatgtctgcatgtatgatgaa
gcggcagcaaaggaccttcagacaagaattgctgaccttggtatcaaggttatgtcagga
atggaaggacttcttgaaatagtatccgttccggaagctgatacagtgcttacagcagtt
gtaggaatgattggtattcagccaactataagagctattgagagcggcaaggatatcgct
cttgccaataaagagacacttgtttgtgcgggacatattattatgccacttgcagcgcag
aaaaaggtacagatattgcccgtagatagtgagcatagcgccattttccagtctttaaac
ggagaaccaagggataaggtagagaaaattcttcttactgccagcggcggtcctttcaga
gggaaaaagagagaagagcttgctaccatgactgctgcagatgctcttaagcatcctaac
tgggatatgggacctaaggtaacaatagattcttcttcacttgtaaataagggacttgaa
gtgatggaagccagatggctctttgatgtgagtcttgataatattcaggttgtggttcat
ccgcagagtattgttcacagtgctgttcagtatgtggatggagcagtaattgcacagctt
ggagttccggatatgaagcttcctatccagtacgcactcttttacccggatagacgacct
atggctgagaagagacttgacctgttcgaacttcacagtctcacttttgaaaaacctgac
acagatacattcagaggtcttaaacttgcttttgatgctgcatatgcagggggcagtatg
cctacagtattcaatgctgcaaacgagatggcggttaaggcgttcctcaagggggatatc
aaatatcttgagatctatgacatgatcgagagagcaatgaatcatcatgttagaattgat
aaccctgatgttgcggctattcttgctgcagaaaaagaaacctacgattatcttggcagg
taa

DBGET integrated database retrieval system