KEGG   Butyrivibrio proteoclasticus: bpr_I1058Help
Entry
bpr_I1058         CDS       T01292                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bpr_I1058 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I1058 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bpr_I1058 (thrC)
Enzymes [BR:bpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     bpr_I1058 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1298542..1300035
Genome map
AA seq 497 aa AA seqDB search
MAKEVLYSSTRGALGQIKASEAILRGLAPDGGLYVPDHIPHLEKTLREIAQLDYRETAYE
VMKLLLTDYTEEELKYCISHAYDSKFDTDEIAPISEAGGAYYLELYHGATIAFKDMALSI
LPYLMTTAAKKNNVKNEIVILTATSGDTGKAALAGFADVPGTRIIVFYPKHGVSPIQEQQ
MVTQKGDNTCVIGIEGNFDDAQTGVKKIFTDKELAKELDAKGFQFSSANSINIGRLVPQI
VYYVYSYAKLLKEGRIADGDSINVVVPTGNFGNILAAYYAKNMGVPIAKLICASNSNKVL
FDFFQTGEYDRNRDFVLTSSPSMDILISSNLERLIYHIAGDDAQKNANLMALLSQDGKYE
ITDNMREQLADFYGGFATEDETAATIRKVFESNGYLMDTHTAVASSVYSKYVQETGDKTV
TVIASTASPFKFTRSVMNALGKGDESKDDFALADELSEVSGVAIPEAVSSIRTAEIRHKT
VVDKADMLKAVCDFLNA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaagttttgtacagtagcaccagaggggctttgggccagattaaggcatct
gaagcaattttaagaggacttgctccagacggaggtttatatgtccctgatcatattccg
catttggaaaaaactctcagagagatagcacagcttgattacagagagacagcttatgag
gtaatgaagcttcttttgaccgattatactgaggaagagctcaaatactgcatttctcat
gcatatgattccaagttcgatacagatgagattgctccaatttcagaggcaggaggagca
tattatcttgagctgtatcacggagctacgattgcttttaaggatatggccctttcaatt
cttccatatcttatgactacagcagccaagaagaataatgtcaagaatgagatagttatt
ctcaccgcaacaagtggagacacaggaaaggcagcacttgctggttttgctgatgtaccc
ggcacaaggatcattgttttttaccctaaacatggtgtaagccctattcaggaacagcag
atggttactcagaagggcgacaatacctgcgttattggaatcgaaggaaactttgacgat
gcgcagaccggagttaagaagatctttacagacaaggaacttgccaaggagcttgatgcc
aagggcttccagttctcatctgcaaattccatcaatataggaagacttgtaccacagatt
gtttactatgtttattcatatgccaaacttctcaaagagggaaggattgctgacggagat
tctataaacgtagtagtacctacaggtaactttggtaatattcttgctgcttattacgcc
aagaatatgggagtgccaattgccaagcttatttgcgcatccaattccaacaaggtattg
tttgatttcttccagacaggtgaatatgacagaaatcgtgactttgttttgacttcatct
ccttctatggatattctgatctcaagtaaccttgagaggcttatttatcatattgcagga
gatgatgcacagaagaatgctaatctgatggctcttttgtctcaggatggtaaatatgag
attactgataatatgagagagcagctggcagatttctatggcggctttgctacagaagac
gagacagcagctacgatcagaaaggtatttgaatcaaacggatatcttatggatacacat
acagcagttgcaagctctgtatacagcaagtatgtccaggagacaggagataagactgta
actgttattgcatcaacagcaagcccgttcaagtttaccagaagcgtaatgaatgcactt
ggaaagggcgatgagagcaaggatgactttgcacttgcagatgaactttcagaggtttca
ggagttgctatacctgaggcagtttcttctatcagaactgcagaaatcagacataagaca
gtagttgataaagctgatatgttaaaagctgtttgcgattttcttaatgcctga

DBGET integrated database retrieval system