KEGG   Butyrivibrio proteoclasticus: bpr_I1068Help
Entry
bpr_I1068         CDS       T01292                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase PfkA2
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00010  Glycolysis / Gluconeogenesis
bpb00030  Pentose phosphate pathway
bpb00051  Fructose and mannose metabolism
bpb00052  Galactose metabolism
bpb00680  Methane metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_I1068 (pfkA2)
   00030 Pentose phosphate pathway
    bpr_I1068 (pfkA2)
   00051 Fructose and mannose metabolism
    bpr_I1068 (pfkA2)
   00052 Galactose metabolism
    bpr_I1068 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    bpr_I1068 (pfkA2)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     bpr_I1068 (pfkA2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     bpr_I1068 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADL33809
UniProt: E0S1Y4
Position
1:1309155..1310414
Genome map
AA seq 419 aa AA seqDB search
MVQKKKRNVIVGQSGGPTAAINSSLAGVYRTAIDRGYQKVYGMIHGVQGLMEGRYVDLSD
HIQSGLDIELLKRTPSAYLGSCRYKLPEIFESKEIYEKIFEILVKLEIDCFIYIGGNDSM
DTIKKLSDYAIITGSDIRFVGCPKTIDNDLALTDHTPGYGSAAKYIGTSVKEIIRDSWSL
ETTSGQVIIVEVMGRNAGWLTGATALAKGEDCDGPDAIYLPELPFDMDAFIKKIKSLLKN
KASVVVAVSEGIRTKDGKYVSELGNSIEYVDAFGHKQLTGTARYLCEVVSQECGCKTRAI
ELSTLQRAASHCASRVDILEAYEVGGAAMKAADEGDSGKMVVIERLSDDPYQAGTEVKDV
HKIANDERTVPRDWINKDGTYVTNEFITYVRPLIQGDVGPIMVDGIPRHLYRPGFQDLL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtacagaaaaagaaacgtaatgttattgttggacagtcgggaggtcctacagcagct
atcaactcatctcttgcgggagtttataggactgcgatcgatcgtggataccagaaggta
tatggtatgatccatggtgttcaaggccttatggaaggaagatatgtagacctttctgat
catattcagagtggacttgatatcgaactcttgaagagaacaccatctgcatatttgggg
tcatgcagatataagcttcctgagattttcgagagtaaagagatatacgagaagatattc
gaaatcctcgttaagttggaaatcgattgcttcatttacatcggtggtaacgactctatg
gataccatcaagaaactttccgactatgctatcatcacaggatctgacattagatttgtt
ggatgtcctaagacaattgataatgatctggctctgacagatcatactcccggatatggc
tcagcagccaagtatatcggaacatcagttaaggagatcatcagagatagctggtcactg
gaaacaactagcggccaggtaattattgtagaggtaatgggtagaaacgcaggctggtta
acaggtgcgacagctcttgccaagggcgaggactgtgacggacctgatgcaatctatctt
cctgagcttccattcgatatggatgcatttatcaagaagatcaagtctttgcttaagaac
aaagcttcagttgttgttgcggtttctgagggtatcagaaccaaggatggcaaatatgtc
agtgagcttggcaacagcatagaatatgtagatgcttttggacacaagcagctaaccgga
acagccagatatctttgcgaagttgtttctcaggaatgcggttgtaagactcgtgccatt
gagctttcaactcttcagagagcagcaagccattgtgcaagccgtgtagatatcctcgaa
gcttatgaagttggcggtgctgccatgaaggctgcagatgagggcgacagcggcaagatg
gtagttattgagagactatccgatgatccttatcaggcaggaactgaggttaaggatgtt
cataagattgctaatgacgagcgtacagttccgagagattggatcaacaaggatggtaca
tatgttactaacgaatttatcacctacgtaagacctcttattcagggtgatgttggacct
atcatggttgatggtattccaagacatttgtacagacctggtttccaggatcttctttga

DBGET integrated database retrieval system