KEGG   Butyrivibrio proteoclasticus: bpr_I1111Help
Entry
bpr_I1111         CDS       T01292                                 

Gene name
rfbC1
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase RfbC1
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00521  Streptomycin biosynthesis
bpb00523  Polyketide sugar unit biosynthesis
bpb01130  Biosynthesis of antibiotics
Module
bpb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    bpr_I1111 (rfbC1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bpr_I1111 (rfbC1)
Enzymes [BR:bpb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     bpr_I1111 (rfbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_1
Motif
Other DBs
NCBI-ProteinID: ADL33851
UniProt: E0S226
Position
1:1369282..1369812
Genome map
AA seq 176 aa AA seqDB search
MIYEKLLVEGCYLFKRNIPKDERGYFSRIADVNEIKKTGLNAEFVQISASRNYKKGTLRG
MHMQIGTSAEEKYISCVEGEVYDVCLDLRKTSPTYLKYCSAVLSEENGYAIYIPKGCAHG
FVSLRDNSQLIYFMTNEHDKQAERGYLWSDPAFSIDWPILPEVISDRDNNWPLYEV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaaaaattacttgttgaaggatgttatcttttcaaaagaaatattcctaaa
gatgaaagaggatatttttctaggatagcagatgttaatgaaataaaaaagactgggcta
aatgctgagtttgttcaaattagtgcatcgagaaattataaaaaaggcactttacgagga
atgcatatgcagattggcacatcagcagaagagaaatatatttcatgtgttgagggagaa
gtatatgacgtatgcttagatcttagaaaaacatcgcctacatacttaaagtattgcagc
gcagtattatcagaggaaaatggatatgctatttatattcctaagggatgcgcacatggg
tttgtttcgcttagagataattcacaactgatttattttatgactaacgagcatgacaaa
caagctgagagaggttatttatggagcgacccagctttttccattgattggccaattttg
ccggaagtaatctctgatagagataataattggccattatatgaggtgtga

DBGET integrated database retrieval system