KEGG   Butyrivibrio proteoclasticus: bpr_I1140Help
Entry
bpr_I1140         CDS       T01292                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase beta subunit TrpB2 (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bpr_I1140 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I1140 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bpr_I1140 (trpB2)
Enzymes [BR:bpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bpr_I1140 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1402733..1404112
Genome map
AA seq 459 aa AA seqDB search
MSEEMKIPYKIYLSEDEIPRQWYNVRADMKNKPAPLLNPATLKPMTFDDLRPVFCDELIK
QELDDTTPYIDIPDEVMDFYRMYRPAPLVRAYFLEKALGTPAKIYYKFEGNNTSGSHKLN
SAIVQAYYAKKQGLKGVTTETGAGQWGTALSMASAYFGIDCKVYMVKVSYEQKPFRREVM
RTYGASVTPSPSMDTEIGRKINAEHPGTTGSLGCAISEAVEVATKTEGYRYVLGSVLNQV
LLHQTVIGLEAKAALDKYGVKPDIIIGCAGGGSNLGGLISPFMGEKLRGEADYRIIAVEP
ASCPSLTRGKFAYDFCDTGMVCPLAKMYTLGSNFIPSANHAGGLRYHGMSPILSQLYDDG
LMEARSVEQTSVFEAAQQFARVEGILPAPESSHAIRAAIDEALKCKETGEEKTILFGLTG
TGYFDMVAYQKFNDGVMMDYIPTDAELQKSFDTLPKINL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaatgaagattccttacaaaatttatcttagcgaagatgagatacccagg
cagtggtacaatgtcagagctgatatgaagaataaaccggctccacttctcaacccggct
actctcaaacctatgacttttgatgatttgagacctgtgttctgtgatgagctgatcaag
caggagcttgatgatacaactccttatattgatattcctgatgaagtcatggacttttac
agaatgtacagaccggcgcctttagtaagagcatatttccttgagaaggcacttggaaca
ccggccaagatttattataaatttgagggtaataatacaagtggcagccataagcttaat
tctgctatcgttcaggcatattatgccaagaagcagggacttaaaggcgttactacagaa
accggtgccggccagtggggaacagctttgtctatggcttcagcctattttggaatagac
tgtaaggtttatatggttaaggtttcatatgagcagaaaccattcagaagagaagtaatg
cgtacttatggagccagcgtaactccttcaccttcaatggatactgagataggacgcaag
ataaatgctgagcatccgggaactacaggaagtcttggctgtgcaatttccgaggcagtt
gaggttgctaccaagactgaaggctacagatatgtacttggaagcgtgctcaatcaggtg
cttcttcatcagaccgtaataggtcttgaagctaaggctgcacttgataagtatggcgtt
aagcctgatattatcattggatgcgccggcggcggatcaaaccttggaggacttatttct
ccgttcatgggagaaaagctccgtggagaagctgattacagaataattgctgtagagcct
gcaagctgcccgtctcttacaaggggtaagtttgcttatgatttctgcgataccggtatg
gtgtgtcctcttgccaagatgtacacacttggaagtaactttattccttctgctaatcat
gcgggcggtcttcgctatcatggcatgagcccgattctttcccagctttatgatgatggc
cttatggaagcaagatcagttgagcagacttcagtatttgaggctgctcagcagtttgcg
agagttgaaggaatccttccggctcccgagtcaagtcatgcaatcagagcagctatcgat
gaagctcttaagtgcaaggagacaggtgaggaaaagacaattctctttggacttacaggt
actggctactttgatatggttgcttatcagaagttcaacgatggagtcatgatggactac
attcctacagatgctgagcttcagaagagctttgatacacttcccaagatcaatctttga

DBGET integrated database retrieval system