KEGG   Butyrivibrio proteoclasticus: bpr_I1140Help
Entry
bpr_I1140         CDS       T01292                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase beta subunit TrpB2
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00260  Glycine, serine and threonine metabolism
bpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01130  Biosynthesis of antibiotics
bpb01230  Biosynthesis of amino acids
Module
bpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I1140 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bpr_I1140 (trpB2)
Enzymes [BR:bpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bpr_I1140 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL33880
UniProt: E0S255
Position
1:1402733..1404112
Genome map
AA seq 459 aa AA seqDB search
MSEEMKIPYKIYLSEDEIPRQWYNVRADMKNKPAPLLNPATLKPMTFDDLRPVFCDELIK
QELDDTTPYIDIPDEVMDFYRMYRPAPLVRAYFLEKALGTPAKIYYKFEGNNTSGSHKLN
SAIVQAYYAKKQGLKGVTTETGAGQWGTALSMASAYFGIDCKVYMVKVSYEQKPFRREVM
RTYGASVTPSPSMDTEIGRKINAEHPGTTGSLGCAISEAVEVATKTEGYRYVLGSVLNQV
LLHQTVIGLEAKAALDKYGVKPDIIIGCAGGGSNLGGLISPFMGEKLRGEADYRIIAVEP
ASCPSLTRGKFAYDFCDTGMVCPLAKMYTLGSNFIPSANHAGGLRYHGMSPILSQLYDDG
LMEARSVEQTSVFEAAQQFARVEGILPAPESSHAIRAAIDEALKCKETGEEKTILFGLTG
TGYFDMVAYQKFNDGVMMDYIPTDAELQKSFDTLPKINL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaatgaagattccttacaaaatttatcttagcgaagatgagatacccagg
cagtggtacaatgtcagagctgatatgaagaataaaccggctccacttctcaacccggct
actctcaaacctatgacttttgatgatttgagacctgtgttctgtgatgagctgatcaag
caggagcttgatgatacaactccttatattgatattcctgatgaagtcatggacttttac
agaatgtacagaccggcgcctttagtaagagcatatttccttgagaaggcacttggaaca
ccggccaagatttattataaatttgagggtaataatacaagtggcagccataagcttaat
tctgctatcgttcaggcatattatgccaagaagcagggacttaaaggcgttactacagaa
accggtgccggccagtggggaacagctttgtctatggcttcagcctattttggaatagac
tgtaaggtttatatggttaaggtttcatatgagcagaaaccattcagaagagaagtaatg
cgtacttatggagccagcgtaactccttcaccttcaatggatactgagataggacgcaag
ataaatgctgagcatccgggaactacaggaagtcttggctgtgcaatttccgaggcagtt
gaggttgctaccaagactgaaggctacagatatgtacttggaagcgtgctcaatcaggtg
cttcttcatcagaccgtaataggtcttgaagctaaggctgcacttgataagtatggcgtt
aagcctgatattatcattggatgcgccggcggcggatcaaaccttggaggacttatttct
ccgttcatgggagaaaagctccgtggagaagctgattacagaataattgctgtagagcct
gcaagctgcccgtctcttacaaggggtaagtttgcttatgatttctgcgataccggtatg
gtgtgtcctcttgccaagatgtacacacttggaagtaactttattccttctgctaatcat
gcgggcggtcttcgctatcatggcatgagcccgattctttcccagctttatgatgatggc
cttatggaagcaagatcagttgagcagacttcagtatttgaggctgctcagcagtttgcg
agagttgaaggaatccttccggctcccgagtcaagtcatgcaatcagagcagctatcgat
gaagctcttaagtgcaaggagacaggtgaggaaaagacaattctctttggacttacaggt
actggctactttgatatggttgcttatcagaagttcaacgatggagtcatgatggactac
attcctacagatgctgagcttcagaagagctttgatacacttcccaagatcaatctttga

DBGET integrated database retrieval system