KEGG   Butyrivibrio proteoclasticus: bpr_I1299Help
Entry
bpr_I1299         CDS       T01292                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00330  Arginine and proline metabolism
bpb00332  Carbapenem biosynthesis
bpb01100  Metabolic pathways
bpb01130  Biosynthesis of antibiotics
bpb01230  Biosynthesis of amino acids
Module
bpb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    bpr_I1299 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    bpr_I1299 (proB)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     bpr_I1299 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Nic96
Motif
Other DBs
NCBI-ProteinID: ADL34037
UniProt: E0RUJ6
Position
1:1616588..1617388
Genome map
AA seq 266 aa AA seqDB search
MSVSKKRIVVKVGTSTITNESGNIDIRAIDHLCRAISGVENLGYDLVLVSSGAIAVGANK
MRLQQKPQEIKLKQAAAAVGQTELMHLYDKLFGEYNRMVGQILLDNEDIADPVRSKNLRN
TFDALLENHIIPIVNENDSVSHAEIESEKKLFSDNDMLSALVAVFCNASKLIIFSDIEGL
YDGNPQTDPSAKLISRVEEITDELKSVASGSGSNRGTGGMITKLEAAELATSHGIDVLIT
NGKNPERLYDIIDKKKVGTLFVAREV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcagcaagaagagaattgtagttaaagtcggaacatcaacaattaccaatgaa
tccggaaatattgatatcagagcgatagaccatctgtgcagagcaatttcaggcgttgag
aatcttggatatgaccttgtgcttgtatcctccggagctattgcggttggagccaacaag
atgagacttcagcaaaaacctcaggaaattaagctcaaacaggctgctgctgcagttgga
cagacagaacttatgcatttatatgataagctctttggcgagtacaacagaatggtaggc
cagatactgcttgataatgaggatattgctgatcctgtgagaagtaagaacctcaggaac
acatttgatgctcttttggaaaaccatattattcctatcgtcaatgagaatgactcagta
agccatgctgagattgaatctgaaaaaaagctcttttccgataacgacatgttatcagct
cttgtggcagtattttgcaatgccagtaagctcattattttttctgatatagagggattg
tatgacggaaatcctcagactgatccaagtgccaagcttatcagcagagtagaggaaata
actgatgagcttaaatcggttgcgtctggatcgggttctaacagaggaaccggaggtatg
atcaccaagcttgaagcggctgaacttgcaacttctcatggaattgatgttcttatcact
aatggcaagaatcctgagcgcctttacgatattattgataaaaagaaggttggaacgctg
tttgttgccagggaagtgtaa

DBGET integrated database retrieval system