KEGG   Butyrivibrio proteoclasticus: bpr_I1449Help
Entry
bpr_I1449         CDS       T01292                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00340  Histidine metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01230  Biosynthesis of amino acids
Module
bpb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    bpr_I1449 (hisD)
Enzymes [BR:bpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     bpr_I1449 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF2188
Motif
Other DBs
NCBI-ProteinID: ADL34186
UniProt: E0RUZ5
Position
1:complement(1780332..1781624)
Genome map
AA seq 430 aa AA seqDB search
MKTLQLNSKTKQELLGNLLNRNPGSYTQYEQTVNEIIENVRINGDKALFDYTLKFDKCEL
DASKVTVTRQEIEDAYAKLSPDFIEVMKKSADNIRVFHEKQKRNSWIETKEDGSILGQRI
LPIEISGVYVPGGKAAYPSSVLMNVVPAKVAGVERIIMCTPPQADGSVNPGTLVAADIAG
VDEVYKVGGAQAIAAMAFGTESIPKVDKITGPGNIFVALAKKACFGHVSIDSIAGPSEIL
VLADDTARARYVAADLLSQAEHDELASAILVTTSQKLADEVSNEIEELLKTLSRADIIRK
SLENYGYIFVADTMEDAIDAANAVASEHLEIITSNPFEVMTKIKNAGAIFLGEYSSEPLG
DYFAGPNHILPTNRTARFFSPLNVDDFMKKSSIIAYSREALEKVHKDIELFAKEESLTAH
ANSIAVRFEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttgcagttaaattccaagacaaaacaggagttacttggaaatctattaaac
agaaatcccggaagctatacgcagtatgaacaaactgttaatgagataattgaaaacgtc
agaattaacggagataaggctttatttgattacacgcttaagtttgataaatgtgagctt
gacgcatctaaagttacggttaccagacaggagatagaagatgcctacgcaaagctttca
cctgattttattgaggtgatgaaaaaaagcgctgataacatcagggtatttcacgaaaaa
caaaagcgtaattcctggatagaaacaaaagaagatggaagtattttagggcagagaatc
ctgccgatagaaatatccggagtttatgttcccggtggtaaagctgcttacccatcaagt
gttcttatgaatgttgttccggccaaggttgcaggagttgaacgtattataatgtgtact
ccgcctcaggcagatggctcagttaaccctggaacacttgtagctgctgatatagcagga
gttgatgaagtatacaaagttggcggagctcaggcaatagctgcaatggcatttggaact
gagagtattccaaaagtagataagatcactggtccaggtaatatttttgttgctcttgct
aaaaaggcttgttttggacatgtttcaattgactcaatagctggcccaagtgagattctt
gtacttgcagatgatacagcaagggcaagatatgtagctgcagatttgctttctcaagct
gaacacgatgagcttgccagtgcaattctcgtaactacttcccaaaagcttgctgacgag
gtttcaaacgaaattgaggaattattaaagaccttatcaagagcagatataatccgcaaa
tctcttgaaaactacggttatatatttgtcgcagacactatggaagatgctatagatgct
gctaacgcagttgcttctgagcacctggagataataacttctaatccttttgaggtcatg
accaagattaaaaatgcaggagctattttccttggagaatattcttcagagccccttgga
gactactttgcgggccctaatcacattcttcctacaaatagaactgctagatttttctca
ccgcttaacgttgacgactttatgaaaaagagcagtattattgcctattcaagagaggca
cttgaaaaggttcacaaggatattgaactgtttgcaaaagaagaaagccttacagctcac
gctaattccatagcagtgagatttgaaaaataa

DBGET integrated database retrieval system