KEGG   Butyrivibrio proteoclasticus: bpr_I1744Help
Entry
bpr_I1744         CDS       T01292                                 

Gene name
glpK
Definition
glycerol kinase GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    bpr_I1744 (glpK)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     bpr_I1744 (glpK)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpr_I1744 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2146761..2148263)
Genome map
AA seq 500 aa AA seqDB search
MAKYVMALDSGTTSNRCILFNEKGEMLSIAQKEFTQIFPQPGWVEHDASEIWQTQLSVAR
EAMAKVDAKSEDIAAIGITNQRETVIMWDRKTGQPISHAIVWQCRRTSDFAEKMKKETPG
IVELFQQKTGLKFDPYFSGTKIRWILDNVEGAREKAENGELCFGTVDSWLIYKLTKGKVH
VTDYSNASRTLLFNINTLEWDKELCDLLDIPMSILPEVKPSSGVYGETDPEFFGGPIKIA
GAAGDQQAALFGQTCFNEGDAKNTYGTGCFMLMNTGDKPIYSKNDLLTTIAWGIEGKVTY
ALEGSVYVAGAAIQWLRDELRVIDSAPDSEYFATRVNDTNGCYVVPAFTGLGAPYWDPYA
RGAIVGLTRGVNKYHIIRATLESLAFQTYDVLHAMELDTGKKITSLRVDGGASKNNFLMQ
FQSDIINTNVIRPSCVETTALGAAYLAGYAVGFWKDRDDVCSNWSIEKTFASQMSSEERE
KELKGWQQAVASTRGWAKEV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatatgtaatggcactggattcaggcacaacaagcaacaggtgcatacttttt
aacgaaaagggagagatgctcagtatcgcccagaaggagttcacacagatatttcctcag
ccgggatgggttgagcatgatgcaagcgaaatctggcagactcagctgtctgtagcccgc
gaggctatggccaaagttgatgcaaagagtgaagacattgcggctattggaattaccaat
cagcgtgaaacagttattatgtgggacagaaagacaggtcagccgatttcacatgcaatc
gtatggcagtgccgcagaacttctgattttgcagagaagatgaaaaaagagactcccgga
attgtggagcttttccagcaaaaaacaggccttaaatttgatccttatttctccggaacc
aagatcagatggatacttgataatgtagagggagccagagaaaaggcagaaaatggagag
ctgtgctttggaactgttgattcatggcttatttacaagctgactaagggaaaggttcat
gttactgattattccaatgcttcgagaactcttttgttcaatatcaatacccttgagtgg
gataaggaattgtgtgacctattggatatcccaatgagtattcttcctgaagttaagcct
tcaagcggtgtttatggtgagacagatccggagttctttggaggacctatcaagatcgca
ggtgctgcgggagatcagcaggcagctctttttggacagacctgttttaatgagggtgat
gccaagaatacctatggaacaggctgtttcatgctgatgaatacaggcgataagccaatt
tattccaagaatgaccttcttacaacaatcgcatggggaattgaaggtaaggttacatat
gctcttgaaggctcagtatatgtggcaggagcagcaattcagtggctcagagatgaactg
agggtaatagattcagctccggactcagagtattttgcaacaagagttaatgatacaaac
ggctgctacgtggttccggcatttacaggacttggcgctccatattgggatccatatgca
agaggagctattgttggccttacacgcggcgtcaacaaataccacataataagagcaaca
ctggagtctctggcgttccaaacctatgatgttcttcatgctatggagctcgatacaggt
aagaagatcacttcacttcgagtagatggcggagcttccaagaataacttcctgatgcag
ttccagtcagacatcataaatactaatgttatcagaccaagctgtgttgaaactaccgct
cttggtgcagcctatcttgccggctatgcggttggcttctggaaggacagggatgatgta
tgcagcaactggtcaatagagaaaacttttgcttctcagatgtcttctgaggagagagaa
aaagagcttaagggatggcagcaggctgtagcatcaaccagaggatgggccaaggaagtc
tga

DBGET integrated database retrieval system