KEGG   Butyrivibrio proteoclasticus: bpr_I1795Help
Entry
bpr_I1795         CDS       T01292                                 

Gene name
bhx3B
Definition
(GenBank) beta-N-acetylhexosaminidase Bhx3B
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00520  Amino sugar and nucleotide sugar metabolism
bpb01100  Metabolic pathways
bpb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_I1795 (bhx3B)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    bpr_I1795 (bhx3B)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bpr_I1795 (bhx3B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 DUF1510 ETRAMP 4HB_MCP_1 PAP_PilO Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: ADL34531
UniProt: E0RVB2
Position
1:complement(2205824..2207104)
Genome map
AA seq 426 aa AA seqDB search
MGRIDEQDFDEKRLARRQRRKKSQLIAIIILISTIVLIVGLGAFGIYSIKKVVNAKKAEQ
EEAAAAASSENQEVVIETPQESAPEPEEMTDGDVLEEIVNSCVSELTLEDKVAGLFMVSP
EQFTGVATVVKAGTSTQDALSKYAVGGLYYSAKNIKSVDQITEMIKNTSDMSKYPIFTAV
SEDGSENGAITASIGGIETGEINNSDTAYNAGTSIGAALFGYGFNFCFAPDLDISENGKY
GTEMESVADIAVSMTSALHDSGVTACTYRFPVSGDTKSAAVANEISKEELTTTIYVAYQR
AIGDGQVGAVMMSNVSFPTITGDNTPASLSKVMITDELRGMLGYDGLVVTAPLNEAAITE
NYTSAEAAVNAINAGADMIFLPENFEEAYQGVLDAVNSGAITEDRINESIKRIYRLKYAN
KIDEIK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaatagatgaacaggattttgatgagaagagactggctcgcaggcagcgcagg
aagaagagtcagcttatagctattataattctcatttctacgattgttcttatagtcggg
cttggagcctttggaatatattcgataaaaaaggtagttaatgccaaaaaagcagaacag
gaagaagctgccgcggctgcttcgagcgagaatcaggaagtagtcattgaaacgccacag
gagtctgcgcctgaaccggaagaaatgactgatggggatgtcctggaagaaatagtaaat
agttgtgtgagtgagcttacacttgaagataaagttgcaggtcttttcatggtgtcacct
gagcagtttaccggggtggctactgtagttaaggcaggaacaagtactcaggatgccttg
tctaaatatgcagttggtggtctttattattcagccaagaatatcaaatccgtagatcag
attactgaaatgatcaagaatacgtctgatatgagtaaatatcctatctttacagctgta
agcgaagatggaagtgagaacggagcaataacagcttctatcggcggaatagagactggt
gaaataaataactcagatactgcgtacaacgccggaacttccataggcgcagctttgttt
ggatatggttttaatttctgttttgctccggatcttgatatttccgagaacggcaaatat
ggaactgaaatggagtcagtggctgatatcgcagtttctatgacatcagcacttcatgac
agcggagttactgcttgtacctacagattcccggtttccggtgacactaaatctgctgca
gtagcaaatgagatttccaaggaagagcttactacaaccatctatgtagcttatcagagg
gcaattggtgatggacaggtaggagctgttatgatgagtaatgtatcatttcctacaata
acaggagataatactccggcttctttatccaaggttatgatcactgatgaacttagggga
atgctgggatatgatggattagtggtaaccgctcccttaaatgaagctgcaattaccgag
aactacacatctgcagaagctgcggtaaatgcaattaacgccggagcagatatgattttc
cttcctgaaaattttgaagaggcttatcagggtgttctggatgctgttaatagcggagct
attacagaagatagaataaacgaatcaataaaaagaatttacagactaaagtatgcaaac
aaaatagacgaaataaaataa

DBGET integrated database retrieval system