KEGG   Butyrivibrio proteoclasticus: bpr_I2043Help
Entry
bpr_I2043         CDS       T01292                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bpb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2491033..2492004
Genome map
AA seq 323 aa AA seqDB search
MDNSIKFLGEDDFLSAMENENKKWRKEHVTRGTLTSFDGTRLNYYIATPKEPRGSITIVH
GMGEFWGKYHEYAWYLYQAGYKVFFMELRGHGYSEGKVSDPQLIYIDDYNTYAEDLLSFV
ETVVVPESDGLDMKLICHSMGGAISVLFLEKHPQYFKSAILNSPMLKMKAEKNLSPFVIF
FLKLYGKIFRKEKSIAPNQKRFDQNTTLENSSAKSRSRFEYQLALRKKDEHYQTTGATLG
WALASVKVTKDIFKHINNIKIPIDIFTAGQDHLINPAGYDMFKEMLPQTRIHAYNESRHE
IFNADEATRKRYYTEVLEVLNGK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggacaattcaatcaagtttctcggagaagatgatttcctctccgcaatggaaaacgaa
aacaaaaaatggcgcaaagagcacgtcacaagaggaacgctcacaagctttgacggaacc
agacttaactactacattgctactcccaaagagcccaggggaagtattacgatagtccac
ggaatgggcgaattctggggaaaatatcacgaatatgcctggtatttatatcaggcaggc
tacaaggtatttttcatggaactaagaggccatggatactcagagggtaaagtttcagac
ccgcagctcatctatatcgatgactacaatacctacgctgaggatcttcttagttttgtt
gaaacagtggtagttcctgaaagtgacggccttgatatgaagctgatatgtcattcaatg
ggaggcgcaatatctgtgctctttttggaaaagcatccccaatacttcaaatcagcaatc
ctgaattcaccgatgctcaagatgaaagcagaaaaaaatctatcgccatttgtcattttc
tttctaaaactatatggaaagatcttcaggaaggaaaagagtattgctccaaaccagaag
cgttttgaccagaacacgactttagaaaacagcagtgccaaatcaaggtcccgttttgaa
tatcagctcgctcttcgcaagaaagatgaacattatcagaccacaggagccactcttggc
tgggcacttgcaagcgtcaaagtcacgaaggacattttcaaacatatcaataatataaaa
ataccgatagatatctttacagcaggccaggatcatttgattaaccctgcaggctatgat
atgtttaaagagatgcttccccaaaccagaattcacgcctataatgagtcaaggcatgaa
atattcaatgcggacgaagccactcgcaaacgctattacactgaagttcttgaggttcta
aatggcaaataa

DBGET integrated database retrieval system