KEGG   Butyrivibrio proteoclasticus: bpr_I2084Help
Entry
bpr_I2084         CDS       T01292                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase Fbp
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00010  Glycolysis / Gluconeogenesis
bpb00030  Pentose phosphate pathway
bpb00051  Fructose and mannose metabolism
bpb00680  Methane metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_I2084 (fbp)
   00030 Pentose phosphate pathway
    bpr_I2084 (fbp)
   00051 Fructose and mannose metabolism
    bpr_I2084 (fbp)
  Energy metabolism
   00680 Methane metabolism
    bpr_I2084 (fbp)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     bpr_I2084 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 DUF4844
Motif
Other DBs
NCBI-ProteinID: ADL34817
UniProt: E0RVG8
Position
1:complement(2541668..2543623)
Genome map
AA seq 651 aa AA seqDB search
MRDIEYLRLLSKEFPNSRKAGAEIINLRAICALPKGTEYFFSDIHGEYESFSHLLRSSSG
IIRVKIEETFGNMMSESEQLELANLIYYPREVISRYRHDETASSKLLHEHQKIAINRLIA
ICRVVSSKYTRSKVRKKMPQDYAYAIDELLHLDMSDANKKLYYNEIISGIIEIDSADEFI
IALCELIQNLTIDSLHIIGDIFDRGPRPDLVMEEIMNFHDVDIQWGNHDIDWMGAACGNT
ACIANVLRIGTSYNCFDALEDGYGINLRPLSMFAAEVYGDDPCECFRPHLLDENKYDSVN
PDLAAKMCKAISIIQLKLEGQLIQKHPEYKLDNRLLLDKIDYGNGTVTIGKKSYKLNDTN
FPTIDTADPYKLSDGEKELMRTLRLSFIHSQLLIRHVQFLYSHGAMYRVINNNLLYHGCI
PMDDKGNFICMETRDGSFKGKELMDYLNVKIHDAFFLDPRDDADRKQDAVDLMWYLWCGP
RSPLFGKDKITTFEHLFLRHEKELCTEKFNPYYKFAAKEECADKIIKEFGLDPEWAHIIN
GHVPVKTKKGESPVKAGGKLYIIDGGISKAYHEQTGIAGYTLIFNSHHLALAAHKPFVKG
AENTPTIQITEKTKKRILVKDTDVGKSLQKQIEDLKDLMSAYESGLIREKY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagagatatagagtatttacgactgcttagtaaagaatttccaaactccaggaaagca
ggagcagaaattataaatctaagggctatttgcgcacttcccaagggaacagagtatttc
ttttccgatatacatggagaatatgagagcttttcacatcttctcagaagttcatcaggt
atcataagagtcaagatagaagaaacctttggaaacatgatgtctgagtctgaacaactt
gaacttgctaatctgatctattatccgcgtgaagtgatcagcagatacaggcatgatgag
actgcatccagtaagctcctccatgagcatcagaagattgcgatcaacagactaatcgcg
atctgcagagtcgtaagttccaagtacaccagatccaaagtacgtaagaagatgcctcag
gactatgcctatgctattgacgagcttttgcatcttgatatgtctgatgccaacaaaaag
ctttattataatgagatcataagcggtattatcgaaattgactctgcagatgagttcatt
attgccctgtgcgagctcatacagaatctgactattgattcacttcacattataggtgac
atttttgacagaggtccaagacctgatcttgttatggaagagatcatgaatttccatgat
gtggatatccagtggggaaatcatgatattgactggatgggagcagcctgcggaaatacc
gcttgtatagctaatgtactgaggattggcaccagctataactgctttgatgctcttgag
gatggatacggcattaacctgcgcccgctctcaatgtttgccgcagaagtttatggagat
gacccttgtgagtgctttagaccgcatctgctcgatgagaacaagtatgattcagttaat
cctgatctggcggctaaaatgtgcaaggcaatcagtatcatacagctcaaattggaaggc
cagctcatccaaaagcaccctgaatacaagctggataacaggcttttgctcgacaagatc
gattatggtaacggaacagttactattggtaaaaagagctacaaattaaatgacactaac
ttcccaactatagacacagctgacccctacaagctttcagatggtgaaaaagagctgatg
aggacgcttcgtcttagctttatccattcccagcttctgataaggcatgtacagtttcta
tattctcacggagctatgtacagagtgataaacaataatctcctttaccatggctgtatt
ccaatggatgataagggaaacttcatatgcatggagacgagggatggaagctttaaggga
aaagagctgatggattatttgaacgtcaagatccatgatgcatttttccttgatccaaga
gatgatgcagatagaaaacaggacgcagttgacctcatgtggtatctgtggtgtggtcca
agatcacctctttttggcaaagataagataacaacctttgagcatctcttcctcaggcat
gaaaaagagttatgcacagagaagtttaatccatattataaatttgctgccaaagaggag
tgtgccgataaaataattaaagagttcggacttgatcctgagtgggcacatatcataaac
ggtcatgttcctgttaaaaccaagaagggagagagtcctgtaaaggcaggaggtaaactc
tatattattgatggcggtatttccaaggcttaccatgaacagacgggaattgcagggtat
acactaatcttcaattcacaccacctggcacttgccgcccataagccctttgtcaaggga
gctgagaacacacctactatacagataacagagaaaaccaagaagaggatactggtcaaa
gatacagatgttggaaagagtctgcagaagcagattgaagatctcaaagatcttatgagt
gcatatgagagtggactcattagagagaaatattaa

DBGET integrated database retrieval system