KEGG   Butyrivibrio proteoclasticus: bpr_I2261Help
Entry
bpr_I2261         CDS       T01292                                 

Gene name
suc13P
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2762893..2764551)
Genome map
AA seq 552 aa AA seqDB search
MSKNFVDNGPMLNAYPDSMGGKLSDIVSVLEKKEFEDVFQSFYILPSIFNTDLDRGFSVI
DYGINRELADAKDLEALDKLGINLKLDFILNHASVLSPQFQDLVKNGEKSKYADFFINWN
KFWEGCGEMTAEGYIQPDEKYIKDMFFRKPGLPILMVRMPDGKDVPYWNTFYQEVQYKRP
DAQDLMDKIDIQYLAAQRLSARVCEGLDEGKKPAEIDFTGYEEYKDAVVDLLESGRRYLG
QMDLNIKSDLVWEHYRNTLKALSGYGARIVRLDAFAYAPKEPGKKNFLNEPDTWDVLEKV
QKLADEFNVSLLPEIHASYKEKIYETVANKGYMTYDFFLPGLLIYAIEHKNGEVLAKWAK
EIQDKKIRVVNMLGCHDGIPLLDLKGILADEEIEEMIQTIVGRGGYVKDLHGAKNMYYQV
NATYYSALGDDDKKMLFARAIQMFMPGKPQVWYLDLFAGKNDHEAVKRAGAGGHKEINRT
NLSLEQIEAAMGKEVVQKQLELLRLRNTNPAFGFDSNLDIKTNGSVMTFTWTNGEHSISL
DADFADYSYSIK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaattttgtagataacggaccaatgcttaatgcctaccctgatagcatgggc
ggtaagctctctgatattgtttcagttcttgaaaagaaagaatttgaggatgtatttcag
tctttttacatccttccgagcattttcaacactgatctggacagaggcttttcagttatt
gactatggcattaacagagaacttgctgatgcaaaggatttagaggctcttgataagctt
ggaatcaatttaaagcttgattttatcctaaatcatgcgtcagttctttctccacagttt
caggatcttgttaaaaacggtgagaaatccaagtatgctgatttctttatcaactggaac
aaattctgggaaggttgcggagagatgacagctgagggctatattcagcctgatgagaaa
tatatcaaggacatgttctttagaaaacccgggcttccaattttgatggtaaggatgcct
gatggcaaggatgtgccttattggaacacattttatcaggaagttcagtacaagagaccg
gatgctcaggatcttatggacaagattgacatacagtatctggcggctcagagactttct
gcaagagtctgcgagggacttgatgagggtaagaagccggcagaaattgattttaccggt
tatgaagaatataaagatgcggttgttgatcttttggaatcaggcagacgctatcttgga
cagatggatcttaacattaagtctgacctggtttgggagcactatagaaatacacttaag
gctctttcaggatacggagcaaggattgtcaggcttgatgcctttgcttatgcacctaag
gaaccaggcaagaagaatttccttaatgaacctgatacctgggatgtacttgaaaaggtt
cagaaactggctgatgagtttaatgtatctcttttacctgagattcatgcaagctacaag
gagaagatatatgagactgtagctaataagggctatatgacatatgatttcttccttccg
ggacttctgatctatgctattgagcataagaacggagaagtgcttgctaagtgggcaaaa
gagatccaggataagaaaatccgtgttgtaaatatgcttggatgtcatgatggtattccg
cttcttgatctgaagggaatcctggcagatgaagagattgaagaaatgatccagacaatc
gttggaagaggcggatatgtcaaggatcttcacggtgccaagaacatgtactatcaggtg
aatgcaacctattacagtgcgcttggcgatgatgataagaagatgctctttgccagagct
attcagatgttcatgccaggtaaaccacaggtttggtatcttgatctttttgcaggcaag
aacgaccatgaggctgttaagcgtgcaggtgccggcggtcataaggagattaacagaact
aatctatctcttgaacagatcgaagcagcaatgggtaaagaggtagttcagaaacagctt
gaacttcttagacttcgtaacacaaatcctgcatttggatttgattcaaatcttgatatc
aagacaaatggaagtgttatgacatttacctggacaaacggtgaacatagtatttcactt
gatgctgattttgcagattattcatacagtattaaataa

DBGET integrated database retrieval system