KEGG   Butyrivibrio proteoclasticus: bpr_I2429Help
Entry
bpr_I2429         CDS       T01292                                 

Gene name
mal77A
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bpr_I2429 (mal77A)
Enzymes [BR:bpb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     bpr_I2429 (mal77A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2964299..2965822)
Genome map
AA seq 507 aa AA seqDB search
MMAKSNKKQTRACGVLLPIFSLASEYGIGAFSKEAYDFVDFLEKAGQRYWQILPLGPTSY
GDSPYQSFSTFAGNPYFIDITELISLGLLTREEADKYDFGESDEYIDYEKMYKSRFRLLM
SAFENLDKATNAKTIRKEFEDFKKSSDNDWLQDYSLFMALKNANGGRSWNTWEEGIRLRK
KEAIKEALVKYADEVEFYSFLQFLFLKQWSALKAYANGKGIEIIGDIPIYVAFDSADTWA
NPELFQLDKENTPIDVAGCPPDAFSATGQLWGNPLYKWDYHKKTGYKWWMKRIGHCYKLY
DVVRIDHFRGFDEYYAIPYGNPTAEIGEWRKGPGYELFETMKRELGDKKVIAEDLGYLTP
SVIKLVKKTGFPGMKILQFAFDSREESDYLPHNYTKNCIVYTGTHDNETTRGWFDNLPRA
DKKFCKEYLGIHYAKDAVWELIRAAFASVSDTAIIPMQDYLELDMSARVNTPSTLGGNWV
WRMKKDALTDELCGKMHDFARIYGRLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgatggcaaagagtaataagaaacagacaagagcttgcggcgttctgctacctattttt
tcattagcatcagaatatggtataggcgcattttccaaggaagcatatgattttgtggat
tttcttgagaaagcgggacagcgctattggcagattcttccgcttggccctacaagctat
ggggattctccatatcagtctttttcaacttttgccggaaatccatactttatagatata
acagagctgatttcattaggtcttttgaccagggaagaggctgacaaatatgattttggc
gagagcgatgagtacattgactatgagaagatgtacaaatccagattcagactccttatg
agtgcatttgaaaatttggataaggctacaaatgctaagactatcagaaaagagtttgag
gattttaagaagagttctgataatgactggttacaggattattctcttttcatggcactt
aaaaatgctaatggcggaagatcctggaatacttgggaagagggaatcagacttcgtaag
aaagaggctattaaggaagcgcttgttaaatatgctgatgaggtggagttttactcattt
ttgcagttcttgttcctcaagcagtggagcgcgcttaaggcatatgccaacggtaaggga
attgagatcattggagatatcccgatttatgtagcttttgacagtgcagatacctgggct
aatcctgaactctttcagcttgataaggagaatacgcctattgatgtggcaggatgtcct
cctgatgctttttctgcgactggtcagctctggggaaatcctctttataaatgggattac
cacaagaagacaggctacaagtggtggatgaagagaatcggacactgctacaagctctat
gatgtagtcaggatcgatcatttcagaggctttgatgagtattacgcaataccatatggc
aatcctactgccgagattggtgagtggagaaagggccccggctatgagctctttgagact
atgaagagagagcttggcgataagaaggttattgctgaggaccttggatacctgacacct
tcagtaataaagcttgttaagaagacaggcttcccgggcatgaagattttgcagtttgct
tttgattcaagagaagagagtgattatctccctcacaactataccaagaactgcatcgtt
tataccggtacacatgataatgagactaccagaggatggtttgacaatcttccaagagct
gataagaagttctgtaaagagtatcttggcattcactatgccaaggatgctgtttgggag
cttataagagctgcatttgcaagcgtttcagatactgcaattattcctatgcaggattat
ctggagcttgatatgagtgcaagggtcaatactccatcaacccttggcggcaactgggta
tggagaatgaagaaggatgcacttactgatgaattgtgtggtaagatgcatgattttgcc
agaatttatggcagattaagataa

DBGET integrated database retrieval system