KEGG   Butyrivibrio proteoclasticus: bpr_I2430Help
Entry
bpr_I2430         CDS       T01292                                 

Definition
carbohydrate kinase PfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bpr_I2430
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     bpr_I2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2966040..2966978)
Genome map
AA seq 312 aa AA seqDB search
MSKFLVAGVTQIETIVRVDKIPVSYAPITSANESIFTAMGGDAYNESLALEWLGDDVTFM
SIVGRNQDLGMINPPDRKITLSTEYIIPQMKETPTEVVLYDKNRKQQIFEDIKDLRENVY
DMSMVAPIAEACDMMVLANANFCRPFAKEAAARNKPIAVNIRSYKPEKEIYNTDFLEPAK
VLYFSDDTLAEDPYDFIDRISGTYGTEIIILGQGSEGLILFDKTHNLRVHYNTVKTNEVV
NTIGAGNALFACFLHYYMETGDSVNAIKNALLFASYKIGYMGTSNGFMTTDQLEQWRNLI
WGIKKSEFESNS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttcttagtagcaggagttacgcagattgagactatagtcagagtggataaa
atcccggttagctatgctccgattaccagtgctaatgagtcaatctttacagcaatgggc
ggcgatgcatacaatgaatccctggctcttgaatggcttggagatgatgtgactttcatg
tctattgttggaagaaatcaggatcttggcatgatcaatcctcctgacagaaagattact
ctttctacggaatatattattccgcagatgaaggaaactccaacagaggttgttctgtac
gataaaaaccgcaaacagcagatctttgaggatatcaaagatctgagagaaaatgtttac
gatatgtccatggtggcaccaatagcagaggcgtgtgatatgatggttcttgctaatgcc
aatttctgcaggccttttgcaaaagaggcagcggccagaaataaacctattgcagttaat
atcagaagctacaagccagaaaaagagatttataatacagatttccttgaaccggccaag
gtcctttatttcagtgatgacacacttgcagaagatccatatgatttcatcgacagaata
tcaggaacttatggaactgaaataataatcctgggacaaggtagtgagggccttatacta
ttcgataagactcataatctcagagtgcattataatacagttaagactaatgaagttgta
aacacgatcggtgcaggaaatgccctgtttgcctgcttcctgcattattacatggagaca
ggagacagcgtcaatgcaataaaaaatgcacttttgtttgcctcctacaagataggttat
atgggaacctcaaatggtttcatgacaacagatcagcttgaacagtggagaaatctgatc
tggggtattaaaaagagtgagtttgagtcaaattcataa

DBGET integrated database retrieval system