KEGG   Butyrivibrio proteoclasticus: bpr_I2488Help
Entry
bpr_I2488         CDS       T01292                                 

Gene name
thlA1
Definition
(GenBank) thiolase ThlA1
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bpr_I2488 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    bpr_I2488 (thlA1)
   00640 Propanoate metabolism
    bpr_I2488 (thlA1)
   00650 Butanoate metabolism
    bpr_I2488 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    bpr_I2488 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    bpr_I2488 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bpr_I2488 (thlA1)
   00310 Lysine degradation
    bpr_I2488 (thlA1)
   00380 Tryptophan metabolism
    bpr_I2488 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpr_I2488 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bpr_I2488 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bpr_I2488 (thlA1)
Enzymes [BR:bpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bpr_I2488 (thlA1)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpr_I2488 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(3041998..3043206)
Genome map
AA seq 402 aa AA seqDB search
MEENFMAQKVVIAGACRTAIGKMGGALSNTPAAELGSIVIKEALNRAGVKPEMVDEVLMG
CVIQAGLGQNVARQASIKAGLPIEIPAVTLNVVCGSGLNCVNMAADLIKAGEADIVVAGG
MENMSMAPYALPNARFGYRMNNGTVVDTMVNDALTDAFNHYHMMITAENICDRWNLTREE
LDEFSANSQQKCEKAMAEGRFNDEIVPVPVKVKKEMVEFKTDEGPRAGTTVETLSKLKCC
SGKEGGLVTAGNASGINDGAAAVVVMSEEKAKELGVKPMATWVGGALAGVEPEIMGIGPV
AATKKVLKKTGLSLDNIDLIEANEAFAAQSVAVAKDLGFDMSKVNVNGGAIALGHPVGAS
GCRILVTLLHEMAKREDAKKGLATLCIGGGMGCATIVERYEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaactttatggcacagaaggtagttatagcaggtgcatgtagaacagctatc
ggtaagatgggcggagctctcagcaatactcctgcagcagaacttggttcaatcgtaatc
aaggaggcacttaacagagcaggtgttaaacctgagatggtagacgaggtacttatggga
tgcgttatccaggctggacttggacagaacgtagcaagacaggcttccatcaaggctggt
cttcctattgagattcctgcagtaacacttaacgtagtttgtggatctggtcttaactgt
gtcaacatggcagctgacctcatcaaagctggagaggctgacatcgtagttgccggtggt
atggagaacatgtcaatggctccttacgcacttcctaatgcacgttttggatatcgtatg
aacaacggaactgttgtagatacaatggttaacgatgctcttacagacgcttttaatcac
tatcacatgatgatcacagcagagaacatctgtgacagatggaaccttacaagagaggaa
ctcgatgagttctcagctaattctcagcagaagtgcgagaaggctatggctgaaggcaga
ttcaacgacgagatcgttcctgttccagttaaggttaagaaggaaatggttgagttcaag
acagatgagggccctcgtgccggaacaactgttgagactctttctaagcttaaatgctgc
tctggtaaagagggtggtcttgtaacagctggtaatgcatcaggtatcaatgatggtgct
gctgcagttgttgttatgagcgaagagaaggctaaagaacttggtgttaagcctatggct
acatgggttggcggcgctcttgcaggtgttgaacctgaaattatgggtatcggtcctgta
gctgctactaagaaagtactcaagaaaactggtctttcacttgataatatcgatcttatc
gaagctaacgaggcttttgcagcacagtcagttgcagttgctaaggaccttggctttgat
atgagcaaggttaacgtaaatggtggtgctatcgcacttggtcaccctgttggagcatca
ggatgccgtatccttgttactcttcttcatgagatggctaagagagaagatgccaagaag
ggtcttgctactctttgcatcggtggcggaatgggctgcgcaactatcgttgagcgttac
gaggcttaa

DBGET integrated database retrieval system