KEGG   Butyrivibrio proteoclasticus: bpr_I2541Help
Entry
bpr_I2541         CDS       T01292                                 

Definition
pyridoxal phosphate-dependent deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bpb00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3109027..3109977)
Genome map
AA seq 316 aa AA seqDB search
MNNMTPTYKLDSDELNSLYVKREDMIPYSFGGNKARKAALFFEDIEKGDYDYVVTYGSSH
SNHCRVVANMAAASGRKCVIIGPSEVSDSTYNSYMMDLFGAELITVPVDKVSSTIDDKLS
ELRSAGHKPYFIIGGGHGNIGTRAYDQCYQEIRQFEKDNNIKFDYIFFASGTGTTQAGLV
CGQLLNEDDRKIVGISIARKNPRGREVVLDSIREYLGKEPLSVSGKEITENDIQDKTIFI
DDYTGDGYGANSAEIQDTIKESLVKYGMPLDSTYTGKAFLGMKKYIRQKGIADKNILFIH
TGGTPLFFDDLNKMRR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatgacccctacctataaacttgatagcgatgagcttaacagtctttacgtt
aaaagagaggatatgattccctactcatttggcggcaataaggccagaaaagcagctctt
ttttttgaggatatagaaaaaggtgattatgattatgtagtaacctatggcagcagtcat
tccaatcactgccgggttgttgccaatatggcggctgcaagtggcaggaagtgcgttatc
ataggcccttcggaagtaagtgatagcacttataacagctatatgatggatctttttgga
gctgagcttataacagtgcctgtggacaaagtcagcagcacaattgatgataagcttagt
gagcttagaagtgccggtcacaagccatattttataattgggggtggtcatggcaatatc
gggaccagagcctatgaccagtgctatcaggaaataagacagtttgaaaaagacaataac
ataaaattcgactatatcttttttgcatccggtacgggaactactcaggcgggacttgta
tgcgggcagctgttaaatgaagatgacaggaagattgtaggaatcagcatagcaagaaag
aatcccagaggaagagaagtggtgcttgatagcatcagagaataccttggcaaagagccg
ttatcagtatccggtaaagagattactgagaatgatattcaggacaaaacaatctttata
gatgattataccggagatgggtatggggcaaacagtgctgaaatacaggatacaataaaa
gaatcacttgttaagtatggaatgcctcttgatagtacctatacaggtaaggcctttctt
ggaatgaaaaaatacatcagacaaaagggtatcgccgataagaatattttgtttatccac
accggtggaacaccactgttttttgatgaccttaataaaatgcggaggtga

DBGET integrated database retrieval system