KEGG   Butyrivibrio proteoclasticus: bpr_I2648Help
Entry
bpr_I2648         CDS       T01292                                 

Gene name
pfkA3
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bpr_I2648 (pfkA3)
   01230 Biosynthesis of amino acids
    bpr_I2648 (pfkA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_I2648 (pfkA3)
   00030 Pentose phosphate pathway
    bpr_I2648 (pfkA3)
   00051 Fructose and mannose metabolism
    bpr_I2648 (pfkA3)
   00052 Galactose metabolism
    bpr_I2648 (pfkA3)
  Energy metabolism
   00680 Methane metabolism
    bpr_I2648 (pfkA3)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     bpr_I2648 (pfkA3)
Protein phosphatases and associated proteins [BR:bpb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     bpr_I2648 (pfkA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3228928..3230169)
Genome map
AA seq 413 aa AA seqDB search
MNKKNVLVAQSGGPTSAINASLAGVLKATIDSDNYDRCYGAINGVLGVLSENYLDLTDKA
KEDSDFIKLLNQTPAMYLGSCRFKLPEYRDDDSSYSFIFSQFRKLNIGAFFYIGGNDSMD
TVLKLSNYAREIGSDVKIIGVPKTIDNDLCNTDHTPGFGSAAKYIASSLLEIAHDTFIYA
VKSVTIVEIMGRDAGWLTAASALARNGYSTAPHLIYLPEVPFDKEKFISDVRHELSKRNN
VIIAVSEGIRDKDGNYITSSKAMADTFGHQQLSGAGKALEFLVKENIDVKVRSVEINVLQ
RCAAHLASKTDLDESFAQGKKAVALSEEGQTGCMVVLKRISNAPYQVEYSYAQIKDIANE
AKSVPVEWINREENDITEEFIEYLRPLIVGEAEHYYENGIPKYLDISHLNQKH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaaacgttcttgttgcacagtcagggggaccaacttccgcgatcaatgcg
agtcttgcgggagtgttgaaggctacgatcgactcggataattatgatcgatgttatggg
gctattaatggtgttttgggggtgttatcagaaaattaccttgatcttaccgataaggca
aaagaggattcggatttcattaaacttctaaatcaaactcctgctatgtatttgggaagt
tgccgttttaaacttccggagtacagggatgatgattcttcttactcttttattttttca
cagtttagaaagcttaatattggggcctttttctatattggcggcaatgacagtatggat
actgttctcaagttgtcgaattatgccagagaaatcggctcagacgttaagataatcggt
gttcccaagactattgataatgacttgtgcaacacagatcacacaccgggctttggttct
gcagccaaatatattgcaagctctttgcttgaaattgcccatgatacatttatctatgca
gttaaatctgttactattgtcgaaataatggggcgtgatgccggctggctcacagcagcg
tcagctcttgccagaaacggctattctacagcgccgcatcttatttatcttcctgaagtt
ccttttgataaggaaaaatttatctcagatgttcgccatgaactttcaaaacgaaataac
gtaataattgctgtgtccgagggaattagggataaggacggcaactacatcacatccagc
aaggctatggcagatacctttggacaccagcagttgtcaggtgcaggaaaggctttggaa
tttcttgtaaaagagaacattgatgtcaaagttcgttccgtagagatcaatgtacttcaa
agatgtgcggctcatttggcaagtaaaaccgatctcgatgagtcttttgcccagggtaaa
aaagctgtggctctttctgaagaaggacagacaggctgcatggttgtgctaaagagaatt
agcaatgcgccttatcaggtagagtatagctatgcacagatcaaagatattgcaaatgaa
gccaagtctgttcctgtagagtggataaatagggaagaaaacgacataacagaggaattt
atagaatatctcaggccgcttattgttggggaggctgagcattattatgaaaatggaatt
ccaaagtatttggatatttcacacttaaatcaaaagcattaa

DBGET integrated database retrieval system