KEGG   Butyrivibrio proteoclasticus: bpr_I2786Help
Entry
bpr_I2786         CDS       T01292                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00900  Terpenoid backbone biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpr_I2786 (ispE)
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     bpr_I2786 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADL35517
UniProt: E0RZV1
Position
1:complement(3342416..3343288)
Genome map
AA seq 290 aa AA seqDB search
MKIERTAYAKINLGLDVTGRRDDGYHIVRMIMQNVDIYDTLTFEDNDTGEVVLTANQDTI
PTDGSNLICKVAKQLQEEYGVKKGVNIHLVKRIPVAAGMAGGSTDGAAAYMALNELWNLG
LDKKRLCELAVKLGADIPYCILGGTALAEGIGEELTIISDMPKCSIVVAKPNIDVSTGWV
YKELDSKEIENHPDIDGIRKAIEEGNLEEMCGLIGNVLEPVTSSKYEEIGKLEALLTKAG
AIGAFMTGSGPTVFGIFDDEALAKKGYESLCDSGMKLQVFLSGPINPNKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagagagaacagcatacgccaaaatcaatctgggactggatgttacgggcagg
agagatgacggataccatattgtacgcatgataatgcagaatgtggatatatatgacaca
ctgacttttgaggataacgataccggagaggttgttctgacagccaatcaggatactatt
ccaaccgacggatcgaacctcatctgcaaggttgcaaagcagcttcaggaggaatatgga
gttaaaaagggcgttaatatccaccttgttaaaagaattcccgtagcagccggaatggca
gggggaagtactgacggagctgctgcttatatggcgcttaatgagctctggaatctcgga
cttgataaaaagagattgtgcgaacttgcagttaagcttggagcggacattccatattgc
attctgggaggaactgctctggctgaaggaatcggagaggagcttacgatcatttccgat
atgccaaagtgcagtatagttgtagccaagccgaatatcgatgtttccacaggctgggtg
tacaaggaacttgatagtaaagaaatagagaatcacccggatatagatgggataaggaaa
gctattgaagaaggtaatcttgaggaaatgtgcggactcataggtaatgtacttgagcct
gttacttcttccaaatatgaagagatcggcaagttggaagctcttttaaccaaggcagga
gccattggggcgtttatgactggtagcggtccgactgtatttggaatatttgatgacgaa
gctcttgccaaaaaagggtacgagagcctgtgcgatagcggaatgaagcttcaggtgttc
ctgtcaggaccgattaatcctaataaattatga

DBGET integrated database retrieval system