KEGG   Butyrivibrio proteoclasticus: bpr_I2927Help
Entry
bpr_I2927         CDS       T01292                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    bpr_I2927
  Metabolism of other amino acids
   00480 Glutathione metabolism
    bpr_I2927
Enzymes [BR:bpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     bpr_I2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3514292..3514834
Genome map
AA seq 180 aa AA seqDB search
MGFYDYSVTDAQGNEVSMADFKGKVVLVVNTATGCGFTPHYKDIEAMYEQYHDQGLEVLD
IPCNQFAGQTPGTDDEIHEFCQLHYNTKFPQMTKSEVNGEGQLPLYKFLKEQKGFEGFGK
GPAALAMSVMLKKIDKDYKNNPDIKWNFTKFVVDREGNVVARFEPTEDMKKVAECVASLI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggattttatgattattctgtaactgatgctcagggaaacgaagtttctatggctgat
ttcaagggcaaggtagttcttgttgttaacactgctacaggttgtggcttcacacctcat
tacaaggatatcgaggctatgtatgagcagtatcatgatcagggtcttgaggttcttgat
atcccttgtaaccagttcgctggacagactcctggtacagacgatgagattcatgagttc
tgccagcttcattacaatactaagttccctcagatgactaagtcagaggttaacggtgag
ggtcagcttcctctttacaagttcctcaaggagcagaagggctttgaaggtttcggcaag
ggacctgcagctcttgctatgagtgttatgctcaagaagattgataaagattacaagaat
aatcctgatattaagtggaacttcactaagttcgttgtagatcgtgagggtaatgttgta
gcccgcttcgagcctacagaagacatgaaaaaggttgcagagtgtgtagcatctcttatc
taa

DBGET integrated database retrieval system