KEGG   Butyrivibrio proteoclasticus: bpr_III021Help
Entry
bpr_III021        CDS       T01292                                 

Definition
(GenBank) carbohydrate kinase ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00010  Glycolysis / Gluconeogenesis
bpb00052  Galactose metabolism
bpb00500  Starch and sucrose metabolism
bpb00520  Amino sugar and nucleotide sugar metabolism
bpb00521  Streptomycin biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_III021
   00052 Galactose metabolism
    bpr_III021
   00500 Starch and sucrose metabolism
    bpr_III021
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_III021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bpr_III021
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    bpr_III021
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bpr_III021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADL35711
UniProt: E0S2S9
Position
2:24067..25035
Genome map
AA seq 322 aa AA seqDB search
MFRIGIDIGGTNIAAGIVDESYKIVKKKTIKTRNVSTPSEMIQAIAGLVKDLMKSAMVKA
DMVTAIGVGVPGTLDPESGKVLYANNLGFEDVPFLTELKKALGEELADKVYFDNDANAAA
IGEYITGDYNAKNFVMMTIGTGIGGGVIINGRVLRGCNYAAAEFGHMTINFDGVDCNCGR
KGCFEDYASVEGLMNLAWEASRSSSGKKSLLGKVSKREELDGEIFFDAVRKGDKVAKKVL
DEYLFYLSEGIINIINIFQPDVLTLSGGITKAADLYLDKLKDLVSKGIYSRNSSKNTEIM
LSKGISDSGDIGIIGAALIYKM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaataggcattgatataggcggaacaaatatagcagcggggattgtagatgaa
tcctacaaaatagtcaaaaagaaaacaattaagaccagaaatgtcagtacgccatcagag
atgatacaggctattgcaggactggtcaaagatcttatgaagtcagccatggtcaaggca
gatatggtcactgccataggcgtcggagttccgggaactcttgatccggagtctgggaaa
gtgctatatgccaacaatttgggctttgaggatgtgccttttttgacagagcttaaaaag
gcgcttggagaagaacttgcagataaagtttattttgataatgatgccaacgctgcagct
atcggagaatacataacaggtgattacaatgccaagaactttgtcatgatgacgattggc
acagggattggcggcggagttatcataaacggccgtgtccttaggggctgtaattatgca
gctgctgagtttggccatatgacaattaactttgacggtgttgactgtaactgcgggaga
aagggatgctttgaggattatgcttctgttgagggacttatgaatcttgcctgggaagct
tccagatcatcctcaggtaaaaagagcctgcttggcaaagtgtccaaaagagaagaactt
gacggagaaatattctttgatgctgtaagaaaaggagataaggtcgcaaaaaaagttttg
gatgagtacttgttctacctgtcggagggcattatcaatatcatcaacatattccaaccg
gatgtgctgacacttagcggagggatcaccaaggcggcggatttgtaccttgataagcta
aaagacctggtttctaagggtatatattcgcgaaatagcagcaagaatacagagataatg
ttgtctaagggaatttcagacagtggcgatatcggtataatcggagctgcacttatatac
aagatgtga

DBGET integrated database retrieval system