KEGG   Butyrivibrio proteoclasticus: bpr_III021Help
Entry
bpr_III021        CDS       T01292                                 

Definition
carbohydrate kinase ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bpr_III021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_III021
   00052 Galactose metabolism
    bpr_III021
   00500 Starch and sucrose metabolism
    bpr_III021
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_III021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bpr_III021
   00524 Butirosin and neomycin biosynthesis
    bpr_III021
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bpr_III021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:24067..25035
Genome map
AA seq 322 aa AA seqDB search
MFRIGIDIGGTNIAAGIVDESYKIVKKKTIKTRNVSTPSEMIQAIAGLVKDLMKSAMVKA
DMVTAIGVGVPGTLDPESGKVLYANNLGFEDVPFLTELKKALGEELADKVYFDNDANAAA
IGEYITGDYNAKNFVMMTIGTGIGGGVIINGRVLRGCNYAAAEFGHMTINFDGVDCNCGR
KGCFEDYASVEGLMNLAWEASRSSSGKKSLLGKVSKREELDGEIFFDAVRKGDKVAKKVL
DEYLFYLSEGIINIINIFQPDVLTLSGGITKAADLYLDKLKDLVSKGIYSRNSSKNTEIM
LSKGISDSGDIGIIGAALIYKM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaataggcattgatataggcggaacaaatatagcagcggggattgtagatgaa
tcctacaaaatagtcaaaaagaaaacaattaagaccagaaatgtcagtacgccatcagag
atgatacaggctattgcaggactggtcaaagatcttatgaagtcagccatggtcaaggca
gatatggtcactgccataggcgtcggagttccgggaactcttgatccggagtctgggaaa
gtgctatatgccaacaatttgggctttgaggatgtgccttttttgacagagcttaaaaag
gcgcttggagaagaacttgcagataaagtttattttgataatgatgccaacgctgcagct
atcggagaatacataacaggtgattacaatgccaagaactttgtcatgatgacgattggc
acagggattggcggcggagttatcataaacggccgtgtccttaggggctgtaattatgca
gctgctgagtttggccatatgacaattaactttgacggtgttgactgtaactgcgggaga
aagggatgctttgaggattatgcttctgttgagggacttatgaatcttgcctgggaagct
tccagatcatcctcaggtaaaaagagcctgcttggcaaagtgtccaaaagagaagaactt
gacggagaaatattctttgatgctgtaagaaaaggagataaggtcgcaaaaaaagttttg
gatgagtacttgttctacctgtcggagggcattatcaatatcatcaacatattccaaccg
gatgtgctgacacttagcggagggatcaccaaggcggcggatttgtaccttgataagcta
aaagacctggtttctaagggtatatattcgcgaaatagcagcaagaatacagagataatg
ttgtctaagggaatttcagacagtggcgatatcggtataatcggagctgcacttatatac
aagatgtga

DBGET integrated database retrieval system