KEGG   Butyrivibrio proteoclasticus: bpr_III065Help
Entry
bpr_III065        CDS       T01292                                 

Gene name
aga36C
Definition
alpha-galactosidase Aga36C
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bpr_III065 (aga36C)
  Lipid metabolism
   00561 Glycerolipid metabolism
    bpr_III065 (aga36C)
   00600 Sphingolipid metabolism
    bpr_III065 (aga36C)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     bpr_III065 (aga36C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:89277..91469
Genome map
AA seq 730 aa AA seqDB search
MDIRFLEKEKVFVIDTENTSYVMGISGEEGLLGHLYYGDKIDSSDVAYLWKTVEPQVNPT
VDMRDRSSFLDRFPFEYSSNNVGDYRKSSIEITDSNGHTSLLLCYESHEIFGGKRAIAGL
PATFGTADDSMSLEIVLADKVVGIRCILSYSIFAGLDVIARSVRLENLSDNTVYIDKVMS
FTMDMDQEDYKLLTLHGSWARERWMDFREIGFGDTSIESFRGESSHQFQPFMALVQKEDS
QDTGKVYGFSFVYSGNFEAGVTKSQFNSLRVYMGIGAKNFRWTLRPGEKFDAPEVVMTYS
AGGLGKMTRTFHDLFRNHLIRSKYKDMERPILINNWEATYFDFDSDKLIAIAREAKKSGI
EMLVMDDGWFGERNDDNSSLGDWYVNEDKLKGGLKKLVDEVNSLGMKFGIWMEPEMVSPR
SKLFEAHPDWAIQIPRRTPCRSRNQLVLDITRQEVRDYIYGRIRAILTSANIEYVKWDMN
RQLCDLGSLGLDKESQGELSHRYMLAVYELQERMITEFPDLLLENCSGGGARFDAGMLYY
SPQIWCSDDTDAIERLVIQEGTSLIFPLSTMGAHVSDCPNHTVGRTTPFKTRGDVALAGT
FGYELDITRIPEEDRADIPRQVAVYHKYNHLVRGGDYYRIASYQRNHEYDAYIVVSKDKK
EALITYVQVVAKPNSSRKLLKVPGLLADVRYQLEGSDEEILGATLEKVGLSVNPLNGDYR
SELIHLIARK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggatataagatttttggaaaaagaaaaagtatttgtaattgacactgagaacactagc
tatgtcatggggatttccggtgaagaagggcttttaggacatctatattatggggataaa
atagatagctcagatgtagcatatctgtggaaaactgtcgaacctcaggtgaatccgaca
gtggatatgagggacaggagctctttccttgacagatttccttttgagtattcctctaac
aacgttggagattacaggaagagcagcatagagataactgatagtaacggacatacaagt
cttttgctatgctatgaatcccatgagatatttggcggtaaaagagctatagcaggactt
ccggctacttttggaactgcagatgattccatgagccttgaaatagtacttgcagataag
gttgttgggatcaggtgtattttgtcatacagcatttttgccggacttgatgtgatcgca
agatcggtaaggctcgagaacttgtcagataacacagtctatattgataaagtaatgtct
tttaccatggatatggatcaggaggattataaattactgacgcttcatggatcatgggca
agagagcgctggatggattttagggaaatcggatttggagatacttccattgaatccttc
agaggagagtcctcgcaccagttccagccattcatggcattggtacaaaaagaggattcg
caggatacaggtaaggtttatggtttttcttttgtctattccggtaattttgaggctgga
gtaacaaagagccagtttaacagtttaagagtatacatgggaatcggagccaaaaacttt
agatggacattaaggccgggtgaaaaatttgatgcccctgaagttgtaatgacttattca
gctggtggccttggaaagatgaccaggactttccatgatcttttcagaaatcacttgatt
agaagcaagtacaaggatatggagcgccctatcctgatcaataactgggaagctacttat
tttgattttgacagtgacaaactcatcgctattgccagagaagccaagaaaagcggaatt
gaaatgctggtaatggatgatggctggtttggagagcgaaatgatgataattccagcctt
ggagactggtatgtcaacgaggataagcttaagggcggacttaaaaaattagtagatgaa
gtaaattctctagggatgaaattcggcatatggatggagcctgagatggtttctcccaga
tcaaagctctttgaagcgcacccggattgggctatacagattcctagaagaacaccttgc
aggagcagaaatcagttggtgcttgacatcaccaggcaggaagtgcgcgattatatatat
ggaaggatcagagctatccttacaagtgccaacattgaatatgttaagtgggatatgaac
aggcagttgtgtgacctgggttctctgggactggacaaagagtcacagggagagctaagc
catagatatatgctggcagtatatgagcttcaggagcgcatgataactgagtttccggac
cttcttcttgagaactgttccggaggaggagcaagatttgatgcaggaatgttgtactac
agtcctcagatttggtgctcggatgatacagatgcaattgaaaggcttgtaatacaggaa
ggaacaagcctcattttccctcttagtactatgggagcacatgtatctgactgccctaac
cacacagttggaaggactacgccttttaagacacgcggagatgttgctctagcgggaaca
ttcgggtatgagcttgatattaccaggattcctgaagaggatagggctgatattcctcga
caggttgctgtatatcataagtacaatcatcttgtaaggggcggagattactatagaatt
gcctcctatcagagaaatcatgaatatgacgcatatatagtagttagtaaggataaaaaa
gaagcactgataacctatgttcaggtggttgcaaagcctaattcttcgaggaagttactc
aaagttcctggacttttagcagatgtacgttatcagcttgaaggaagcgatgaagagatt
cttggagctacccttgaaaaagtgggactgtctgtgaatccgctaaatggagattacagg
tcagaactgatacatttgatagccaggaaataa

DBGET integrated database retrieval system