KEGG   Butyrivibrio proteoclasticus: bpr_III131Help
Entry
bpr_III131        CDS       T01292                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bpb  Butyrivibrio proteoclasticus
Brite
Enzymes [BR:bpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     bpr_III131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind KR NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: ADL35817
UniProt: E0S335
Position
2:152808..153827
Genome map
AA seq 339 aa AA seqDB search
MSQTNKMYLVTGAAGFLGSTVCRKLVDRNEKVRAFVLEGDKSAAYLPEEVEIVYGDLCNK
DDLERFFDTPENTEVIVLHIASIVTVNPDYSQKVMDVNVGGTENIIEMCKEHNVSKLVYC
SSTGAIPEEEKGSIRECEGSIPLDPERIKGCYSLSKAMATNVVLKAAKEGLNACVVHPSG
ILGPEDFAMGETTKTLVDIINGEMPAGIDGSFNLCDVRDLADGLIGAADKGKSGECYILG
NEPVSFKDFTKLVSEESGCRQMKFFLPISAANFIAKILEKKAKKTGEKPLMTTFSVYNLA
RNNRFDSSKASKELGYTTRSYRETIRDEIRWLKETGKIA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaaataagatgtatctggtaacaggagcagcaggatttcttggaagcaca
gtctgcagaaagcttgttgatagaaacgaaaaagtaagggcatttgtccttgaaggtgat
aagtcagccgcatatcttccggaagaagtagaaatcgtatacggagatctttgtaataaa
gatgacctggagagattctttgacacgcctgaaaatacagaggtgatcgtgcttcacata
gcaagcatcgtaacagttaatcccgactacagccagaaagtcatggacgtaaatgtcggc
gggacagaaaatatcatagagatgtgcaaagagcacaatgtttcaaagctcgtttattgc
tcatcaacaggagcaatacctgaggaagagaagggaagcataagagaatgtgagggttcg
atcccgcttgatcctgagaggatcaaaggctgctattcattgtcaaaggctatggcaaca
aatgtggtgctcaaggctgcaaaggaagggcttaatgcatgtgtggttcacccttcagga
atcctcggacctgaggactttgcaatgggtgagaccacaaagactctggttgatatcatc
aatggtgagatgcccgccggaattgacggaagctttaatctgtgtgatgtaagggatctg
gctgacggactcattggagcagcagataagggaaaaagcggagagtgttacatacttgga
aatgaacctgtcagctttaaggattttacaaagcttgtttcagaggagagtggctgcaga
cagatgaagttctttttacctatatcagcagcaaacttcattgctaagatacttgagaaa
aaagctaaaaagacaggcgaaaagcctcttatgacaactttctctgtttataatcttgca
agaaacaaccgctttgattcaagtaaagcaagtaaggaacttggttatactacaagatca
tacagagaaaccatacgtgacgagatcagatggcttaaagaaactggaaaaattgcataa

DBGET integrated database retrieval system